pipeline_tag
stringclasses 48
values | library_name
stringclasses 198
values | text
stringlengths 1
900k
| metadata
stringlengths 2
438k
| id
stringlengths 5
122
| last_modified
null | tags
sequencelengths 1
1.84k
| sha
null | created_at
stringlengths 25
25
| arxiv
sequencelengths 0
201
| languages
sequencelengths 0
1.83k
| tags_str
stringlengths 17
9.34k
| text_str
stringlengths 0
389k
| text_lists
sequencelengths 0
722
| processed_texts
sequencelengths 1
723
|
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
text-classification | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | HanzhiZhang/CSCE5218_10percent | null | [
"transformers",
"safetensors",
"roberta",
"text-classification",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T20:42:31+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #roberta #text-classification #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #roberta #text-classification #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-classification | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | HanzhiZhang/CSCE5218_100percent | null | [
"transformers",
"safetensors",
"roberta",
"text-classification",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T20:42:42+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #roberta #text-classification #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #roberta #text-classification #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
token-classification | transformers |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# mdeberta_v3_third_run
This model is a fine-tuned version of [microsoft/mdeberta-v3-base](https://huggingface.co/microsoft/mdeberta-v3-base) on an unknown dataset.
It achieves the following results on the evaluation set:
- Loss: 0.3530
- Precision: 0.5567
- Recall: 0.4907
- F1: 0.5216
- Accuracy: 0.8752
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 2e-05
- train_batch_size: 8
- eval_batch_size: 8
- seed: 42
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: linear
- num_epochs: 2
### Training results
| Training Loss | Epoch | Step | Validation Loss | Precision | Recall | F1 | Accuracy |
|:-------------:|:-----:|:-----:|:---------------:|:---------:|:------:|:------:|:--------:|
| 0.3964 | 1.0 | 22210 | 0.3834 | 0.5363 | 0.4512 | 0.4901 | 0.8636 |
| 0.3432 | 2.0 | 44420 | 0.3530 | 0.5567 | 0.4907 | 0.5216 | 0.8752 |
### Framework versions
- Transformers 4.40.0
- Pytorch 2.2.1+cu121
- Datasets 2.19.0
- Tokenizers 0.19.1
| {"license": "mit", "tags": ["generated_from_trainer"], "metrics": ["precision", "recall", "f1", "accuracy"], "base_model": "microsoft/mdeberta-v3-base", "model-index": [{"name": "mdeberta_v3_third_run", "results": []}]} | Gmanc/mdeberta_v3_third_run | null | [
"transformers",
"tensorboard",
"safetensors",
"deberta-v2",
"token-classification",
"generated_from_trainer",
"base_model:microsoft/mdeberta-v3-base",
"license:mit",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T20:44:10+00:00 | [] | [] | TAGS
#transformers #tensorboard #safetensors #deberta-v2 #token-classification #generated_from_trainer #base_model-microsoft/mdeberta-v3-base #license-mit #autotrain_compatible #endpoints_compatible #region-us
| mdeberta\_v3\_third\_run
========================
This model is a fine-tuned version of microsoft/mdeberta-v3-base on an unknown dataset.
It achieves the following results on the evaluation set:
* Loss: 0.3530
* Precision: 0.5567
* Recall: 0.4907
* F1: 0.5216
* Accuracy: 0.8752
Model description
-----------------
More information needed
Intended uses & limitations
---------------------------
More information needed
Training and evaluation data
----------------------------
More information needed
Training procedure
------------------
### Training hyperparameters
The following hyperparameters were used during training:
* learning\_rate: 2e-05
* train\_batch\_size: 8
* eval\_batch\_size: 8
* seed: 42
* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
* lr\_scheduler\_type: linear
* num\_epochs: 2
### Training results
### Framework versions
* Transformers 4.40.0
* Pytorch 2.2.1+cu121
* Datasets 2.19.0
* Tokenizers 0.19.1
| [
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 2e-05\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: linear\n* num\\_epochs: 2",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.40.0\n* Pytorch 2.2.1+cu121\n* Datasets 2.19.0\n* Tokenizers 0.19.1"
] | [
"TAGS\n#transformers #tensorboard #safetensors #deberta-v2 #token-classification #generated_from_trainer #base_model-microsoft/mdeberta-v3-base #license-mit #autotrain_compatible #endpoints_compatible #region-us \n",
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 2e-05\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: linear\n* num\\_epochs: 2",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.40.0\n* Pytorch 2.2.1+cu121\n* Datasets 2.19.0\n* Tokenizers 0.19.1"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | shallow6414/76bbz9s | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T20:45:48+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | golf2248/kr1bssg | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T20:49:55+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers | # GreenBit LLaMA
This is GreenBitAI's pretrained **low-bit** LLMs with extreme compression yet still strong performance.
Please refer to our [Github page](https://github.com/GreenBitAI/green-bit-llm) for the code to run the model and more information.
| {"license": "apache-2.0"} | GreenBitAI/Llama-3-70B-layer-mix-bpw-3.0 | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"conversational",
"license:apache-2.0",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T20:52:27+00:00 | [] | [] | TAGS
#transformers #safetensors #llama #text-generation #conversational #license-apache-2.0 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
| # GreenBit LLaMA
This is GreenBitAI's pretrained low-bit LLMs with extreme compression yet still strong performance.
Please refer to our Github page for the code to run the model and more information.
| [
"# GreenBit LLaMA\n\nThis is GreenBitAI's pretrained low-bit LLMs with extreme compression yet still strong performance.\n\nPlease refer to our Github page for the code to run the model and more information."
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #conversational #license-apache-2.0 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# GreenBit LLaMA\n\nThis is GreenBitAI's pretrained low-bit LLMs with extreme compression yet still strong performance.\n\nPlease refer to our Github page for the code to run the model and more information."
] |
text-classification | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | sezinarseven/akilvedavranisbozukluklari-classification | null | [
"transformers",
"safetensors",
"bert",
"text-classification",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T20:52:30+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #bert #text-classification #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #bert #text-classification #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers | # GreenBit LLMs
This is GreenBitAI's pretrained **low-bit** LLMs with extreme compression yet still strong performance.
Please refer to our [Github page](https://github.com/GreenBitAI/green-bit-llm) for the code to run the model and more information.
| {"license": "apache-2.0"} | GreenBitAI/Llama-3-70B-layer-mix-bpw-2.5 | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"conversational",
"license:apache-2.0",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T20:52:40+00:00 | [] | [] | TAGS
#transformers #safetensors #llama #text-generation #conversational #license-apache-2.0 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
| # GreenBit LLMs
This is GreenBitAI's pretrained low-bit LLMs with extreme compression yet still strong performance.
Please refer to our Github page for the code to run the model and more information.
| [
"# GreenBit LLMs\n\nThis is GreenBitAI's pretrained low-bit LLMs with extreme compression yet still strong performance.\n\nPlease refer to our Github page for the code to run the model and more information."
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #conversational #license-apache-2.0 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# GreenBit LLMs\n\nThis is GreenBitAI's pretrained low-bit LLMs with extreme compression yet still strong performance.\n\nPlease refer to our Github page for the code to run the model and more information."
] |
null | null | CNN model trained on audio dataset from ravdees and savee.
72% Accuracy | {} | Jiraheya/Speech-To-Emotion | null | [
"region:us"
] | null | 2024-04-28T20:53:59+00:00 | [] | [] | TAGS
#region-us
| CNN model trained on audio dataset from ravdees and savee.
72% Accuracy | [] | [
"TAGS\n#region-us \n"
] |
null | peft |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# Meta-Llama-3-8B-Instruct-advisegpt-v0.1
This model is a fine-tuned version of [meta-llama/Meta-Llama-3-8B-Instruct](https://huggingface.co/meta-llama/Meta-Llama-3-8B-Instruct) on the generator dataset.
It achieves the following results on the evaluation set:
- Loss: 0.8847
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 2e-05
- train_batch_size: 6
- eval_batch_size: 6
- seed: 42
- gradient_accumulation_steps: 15
- total_train_batch_size: 90
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: cosine
- num_epochs: 3
- mixed_precision_training: Native AMP
### Training results
| Training Loss | Epoch | Step | Validation Loss |
|:-------------:|:------:|:----:|:---------------:|
| 0.226 | 0.9901 | 87 | 0.8587 |
| 0.1649 | 1.9917 | 175 | 0.8812 |
| 0.1581 | 2.9704 | 261 | 0.8847 |
### Framework versions
- PEFT 0.10.0
- Transformers 4.40.1
- Pytorch 2.3.0+cu121
- Datasets 2.19.0
- Tokenizers 0.19.1 | {"license": "other", "library_name": "peft", "tags": ["trl", "sft", "generated_from_trainer"], "datasets": ["generator"], "base_model": "meta-llama/Meta-Llama-3-8B-Instruct", "model-index": [{"name": "Meta-Llama-3-8B-Instruct-advisegpt-v0.1", "results": []}]} | ninyx/Meta-Llama-3-8B-Instruct-advisegpt-v0.1 | null | [
"peft",
"safetensors",
"trl",
"sft",
"generated_from_trainer",
"dataset:generator",
"base_model:meta-llama/Meta-Llama-3-8B-Instruct",
"license:other",
"region:us"
] | null | 2024-04-28T20:55:59+00:00 | [] | [] | TAGS
#peft #safetensors #trl #sft #generated_from_trainer #dataset-generator #base_model-meta-llama/Meta-Llama-3-8B-Instruct #license-other #region-us
| Meta-Llama-3-8B-Instruct-advisegpt-v0.1
=======================================
This model is a fine-tuned version of meta-llama/Meta-Llama-3-8B-Instruct on the generator dataset.
It achieves the following results on the evaluation set:
* Loss: 0.8847
Model description
-----------------
More information needed
Intended uses & limitations
---------------------------
More information needed
Training and evaluation data
----------------------------
More information needed
Training procedure
------------------
### Training hyperparameters
The following hyperparameters were used during training:
* learning\_rate: 2e-05
* train\_batch\_size: 6
* eval\_batch\_size: 6
* seed: 42
* gradient\_accumulation\_steps: 15
* total\_train\_batch\_size: 90
* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
* lr\_scheduler\_type: cosine
* num\_epochs: 3
* mixed\_precision\_training: Native AMP
### Training results
### Framework versions
* PEFT 0.10.0
* Transformers 4.40.1
* Pytorch 2.3.0+cu121
* Datasets 2.19.0
* Tokenizers 0.19.1
| [
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 2e-05\n* train\\_batch\\_size: 6\n* eval\\_batch\\_size: 6\n* seed: 42\n* gradient\\_accumulation\\_steps: 15\n* total\\_train\\_batch\\_size: 90\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* PEFT 0.10.0\n* Transformers 4.40.1\n* Pytorch 2.3.0+cu121\n* Datasets 2.19.0\n* Tokenizers 0.19.1"
] | [
"TAGS\n#peft #safetensors #trl #sft #generated_from_trainer #dataset-generator #base_model-meta-llama/Meta-Llama-3-8B-Instruct #license-other #region-us \n",
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 2e-05\n* train\\_batch\\_size: 6\n* eval\\_batch\\_size: 6\n* seed: 42\n* gradient\\_accumulation\\_steps: 15\n* total\\_train\\_batch\\_size: 90\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* PEFT 0.10.0\n* Transformers 4.40.1\n* Pytorch 2.3.0+cu121\n* Datasets 2.19.0\n* Tokenizers 0.19.1"
] |
text2text-generation | transformers |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# rouge_1_evals
This model is a fine-tuned version of [](https://huggingface.co/) on an unknown dataset.
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 2e-05
- train_batch_size: 8
- eval_batch_size: 8
- seed: 42
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: linear
- num_epochs: 3
- mixed_precision_training: Native AMP
### Framework versions
- Transformers 4.40.1
- Pytorch 2.1.2
- Datasets 2.19.0
- Tokenizers 0.19.1
| {"tags": ["generated_from_trainer"], "model-index": [{"name": "rouge_1_evals", "results": []}]} | frayline/rouge_1_evals | null | [
"transformers",
"safetensors",
"encoder-decoder",
"text2text-generation",
"generated_from_trainer",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T20:56:51+00:00 | [] | [] | TAGS
#transformers #safetensors #encoder-decoder #text2text-generation #generated_from_trainer #autotrain_compatible #endpoints_compatible #region-us
|
# rouge_1_evals
This model is a fine-tuned version of [](URL on an unknown dataset.
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 2e-05
- train_batch_size: 8
- eval_batch_size: 8
- seed: 42
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: linear
- num_epochs: 3
- mixed_precision_training: Native AMP
### Framework versions
- Transformers 4.40.1
- Pytorch 2.1.2
- Datasets 2.19.0
- Tokenizers 0.19.1
| [
"# rouge_1_evals\n\nThis model is a fine-tuned version of [](URL on an unknown dataset.",
"## Model description\n\nMore information needed",
"## Intended uses & limitations\n\nMore information needed",
"## Training and evaluation data\n\nMore information needed",
"## Training procedure",
"### Training hyperparameters\n\nThe following hyperparameters were used during training:\n- learning_rate: 2e-05\n- train_batch_size: 8\n- eval_batch_size: 8\n- seed: 42\n- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n- lr_scheduler_type: linear\n- num_epochs: 3\n- mixed_precision_training: Native AMP",
"### Framework versions\n\n- Transformers 4.40.1\n- Pytorch 2.1.2\n- Datasets 2.19.0\n- Tokenizers 0.19.1"
] | [
"TAGS\n#transformers #safetensors #encoder-decoder #text2text-generation #generated_from_trainer #autotrain_compatible #endpoints_compatible #region-us \n",
"# rouge_1_evals\n\nThis model is a fine-tuned version of [](URL on an unknown dataset.",
"## Model description\n\nMore information needed",
"## Intended uses & limitations\n\nMore information needed",
"## Training and evaluation data\n\nMore information needed",
"## Training procedure",
"### Training hyperparameters\n\nThe following hyperparameters were used during training:\n- learning_rate: 2e-05\n- train_batch_size: 8\n- eval_batch_size: 8\n- seed: 42\n- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n- lr_scheduler_type: linear\n- num_epochs: 3\n- mixed_precision_training: Native AMP",
"### Framework versions\n\n- Transformers 4.40.1\n- Pytorch 2.1.2\n- Datasets 2.19.0\n- Tokenizers 0.19.1"
] |
null | transformers |
# Uploaded model
- **Developed by:** zz-xx
- **License:** apache-2.0
- **Finetuned from model :** unsloth/gemma-7b-bnb-4bit
This gemma model was trained 2x faster with [Unsloth](https://github.com/unslothai/unsloth) and Huggingface's TRL library.
[<img src="https://raw.githubusercontent.com/unslothai/unsloth/main/images/unsloth%20made%20with%20love.png" width="200"/>](https://github.com/unslothai/unsloth)
| {"language": ["en"], "license": "apache-2.0", "tags": ["text-generation-inference", "transformers", "unsloth", "gemma", "trl"], "base_model": "unsloth/gemma-7b-bnb-4bit"} | zz-xx/gemma-7b-bnb-4bit-bias-lora-model | null | [
"transformers",
"safetensors",
"text-generation-inference",
"unsloth",
"gemma",
"trl",
"en",
"base_model:unsloth/gemma-7b-bnb-4bit",
"license:apache-2.0",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T20:59:13+00:00 | [] | [
"en"
] | TAGS
#transformers #safetensors #text-generation-inference #unsloth #gemma #trl #en #base_model-unsloth/gemma-7b-bnb-4bit #license-apache-2.0 #endpoints_compatible #region-us
|
# Uploaded model
- Developed by: zz-xx
- License: apache-2.0
- Finetuned from model : unsloth/gemma-7b-bnb-4bit
This gemma model was trained 2x faster with Unsloth and Huggingface's TRL library.
<img src="URL width="200"/>
| [
"# Uploaded model\n\n- Developed by: zz-xx\n- License: apache-2.0\n- Finetuned from model : unsloth/gemma-7b-bnb-4bit\n\nThis gemma model was trained 2x faster with Unsloth and Huggingface's TRL library.\n\n<img src=\"URL width=\"200\"/>"
] | [
"TAGS\n#transformers #safetensors #text-generation-inference #unsloth #gemma #trl #en #base_model-unsloth/gemma-7b-bnb-4bit #license-apache-2.0 #endpoints_compatible #region-us \n",
"# Uploaded model\n\n- Developed by: zz-xx\n- License: apache-2.0\n- Finetuned from model : unsloth/gemma-7b-bnb-4bit\n\nThis gemma model was trained 2x faster with Unsloth and Huggingface's TRL library.\n\n<img src=\"URL width=\"200\"/>"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | shallow6414/m1yom59 | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T20:59:22+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
automatic-speech-recognition | transformers |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
[<img src="https://raw.githubusercontent.com/wandb/assets/main/wandb-github-badge-28.svg" alt="Visualize in Weights & Biases" width="200" height="32"/>](https://wandb.ai/bakera-sunbird/huggingface/runs/rycj9ija)
# whisper-medium-ach-only
This model is a fine-tuned version of [openai/whisper-medium](https://huggingface.co/openai/whisper-medium) on the generator dataset.
It achieves the following results on the evaluation set:
- Loss: 0.3942
- Wer: 21.1520
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 1e-05
- train_batch_size: 16
- eval_batch_size: 8
- seed: 42
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: linear
- lr_scheduler_warmup_steps: 500
- training_steps: 4000
- mixed_precision_training: Native AMP
### Training results
| Training Loss | Epoch | Step | Validation Loss | Wer |
|:-------------:|:-------:|:----:|:---------------:|:-------:|
| 1.1662 | 0.05 | 200 | 0.7062 | 47.0255 |
| 0.6014 | 1.0248 | 400 | 0.4606 | 32.9556 |
| 0.5638 | 1.0748 | 600 | 0.4021 | 27.2899 |
| 0.3677 | 2.0495 | 800 | 0.3736 | 24.3626 |
| 0.2711 | 3.0242 | 1000 | 0.3648 | 23.5127 |
| 0.2862 | 3.0743 | 1200 | 0.3402 | 23.7016 |
| 0.2023 | 4.049 | 1400 | 0.3665 | 22.4740 |
| 0.1166 | 5.0237 | 1600 | 0.4023 | 23.6072 |
| 0.1089 | 5.0738 | 1800 | 0.3871 | 22.5685 |
| 0.0859 | 6.0485 | 2000 | 0.3837 | 25.6846 |
| 0.0557 | 7.0232 | 2200 | 0.3942 | 21.1520 |
| 0.0572 | 7.0732 | 2400 | 0.3805 | 22.0963 |
| 0.0469 | 8.048 | 2600 | 0.3995 | 23.6072 |
| 0.0308 | 9.0228 | 2800 | 0.4057 | 21.5297 |
| 0.0288 | 9.0727 | 3000 | 0.3999 | 21.1520 |
| 0.0222 | 10.0475 | 3200 | 0.4121 | 21.7186 |
| 0.0239 | 11.0222 | 3400 | 0.4162 | 21.9075 |
| 0.024 | 11.0723 | 3600 | 0.4154 | 21.9075 |
| 0.0219 | 12.047 | 3800 | 0.4186 | 21.3409 |
| 0.0133 | 13.0218 | 4000 | 0.4173 | 21.1520 |
### Framework versions
- Transformers 4.41.0.dev0
- Pytorch 2.2.0
- Datasets 2.16.1
- Tokenizers 0.19.1
| {"license": "apache-2.0", "tags": ["generated_from_trainer"], "datasets": ["generator"], "metrics": ["wer"], "base_model": "openai/whisper-medium", "model-index": [{"name": "whisper-medium-ach-only", "results": [{"task": {"type": "automatic-speech-recognition", "name": "Automatic Speech Recognition"}, "dataset": {"name": "generator", "type": "generator", "config": "default", "split": "train", "args": "default"}, "metrics": [{"type": "wer", "value": 21.152030217186024, "name": "Wer"}]}]}]} | akera/whisper-medium-ach-only | null | [
"transformers",
"safetensors",
"whisper",
"automatic-speech-recognition",
"generated_from_trainer",
"dataset:generator",
"base_model:openai/whisper-medium",
"license:apache-2.0",
"model-index",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T20:59:41+00:00 | [] | [] | TAGS
#transformers #safetensors #whisper #automatic-speech-recognition #generated_from_trainer #dataset-generator #base_model-openai/whisper-medium #license-apache-2.0 #model-index #endpoints_compatible #region-us
| <img src="URL alt="Visualize in Weights & Biases" width="200" height="32"/>
whisper-medium-ach-only
=======================
This model is a fine-tuned version of openai/whisper-medium on the generator dataset.
It achieves the following results on the evaluation set:
* Loss: 0.3942
* Wer: 21.1520
Model description
-----------------
More information needed
Intended uses & limitations
---------------------------
More information needed
Training and evaluation data
----------------------------
More information needed
Training procedure
------------------
### Training hyperparameters
The following hyperparameters were used during training:
* learning\_rate: 1e-05
* train\_batch\_size: 16
* eval\_batch\_size: 8
* seed: 42
* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
* lr\_scheduler\_type: linear
* lr\_scheduler\_warmup\_steps: 500
* training\_steps: 4000
* mixed\_precision\_training: Native AMP
### Training results
### Framework versions
* Transformers 4.41.0.dev0
* Pytorch 2.2.0
* Datasets 2.16.1
* Tokenizers 0.19.1
| [
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 1e-05\n* train\\_batch\\_size: 16\n* eval\\_batch\\_size: 8\n* seed: 42\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: linear\n* lr\\_scheduler\\_warmup\\_steps: 500\n* training\\_steps: 4000\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.41.0.dev0\n* Pytorch 2.2.0\n* Datasets 2.16.1\n* Tokenizers 0.19.1"
] | [
"TAGS\n#transformers #safetensors #whisper #automatic-speech-recognition #generated_from_trainer #dataset-generator #base_model-openai/whisper-medium #license-apache-2.0 #model-index #endpoints_compatible #region-us \n",
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 1e-05\n* train\\_batch\\_size: 16\n* eval\\_batch\\_size: 8\n* seed: 42\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: linear\n* lr\\_scheduler\\_warmup\\_steps: 500\n* training\\_steps: 4000\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.41.0.dev0\n* Pytorch 2.2.0\n* Datasets 2.16.1\n* Tokenizers 0.19.1"
] |
automatic-speech-recognition | transformers |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# Whisper Large v2 TR
This model is a fine-tuned version of [openai/whisper-large-v2](https://huggingface.co/openai/whisper-large-v2) on the Common Voice 17 dataset.
It achieves the following results on the evaluation set:
- Loss: 0.1568
- Wer: 9.0189
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 1e-05
- train_batch_size: 16
- eval_batch_size: 16
- seed: 42
- gradient_accumulation_steps: 2
- total_train_batch_size: 32
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: linear
- lr_scheduler_warmup_ratio: 0.1
- num_epochs: 3
- mixed_precision_training: Native AMP
### Training results
| Training Loss | Epoch | Step | Validation Loss | Wer |
|:-------------:|:------:|:----:|:---------------:|:------:|
| 0.1437 | 0.9997 | 1450 | 0.1550 | 9.9787 |
| 0.0766 | 2.0 | 2901 | 0.1470 | 9.3616 |
| 0.0371 | 2.9990 | 4350 | 0.1568 | 9.0189 |
### Framework versions
- Transformers 4.40.0
- Pytorch 2.2.2+cu121
- Datasets 2.17.1
- Tokenizers 0.19.1
| {"language": ["tr"], "license": "apache-2.0", "tags": ["whisper-event", "generated_from_trainer"], "datasets": ["mozilla-foundation/common_voice_17"], "metrics": ["wer"], "base_model": "openai/whisper-large-v2", "model-index": [{"name": "Whisper Large v2 TR ", "results": [{"task": {"type": "automatic-speech-recognition", "name": "Automatic Speech Recognition"}, "dataset": {"name": "Common Voice 13", "type": "mozilla-foundation/common_voice_17", "config": "tr", "split": "None", "args": "tr"}, "metrics": [{"type": "wer", "value": 9.018929438770417, "name": "Wer"}]}]}]} | tgrhn/whisper-large-tr-cv17 | null | [
"transformers",
"tensorboard",
"safetensors",
"whisper",
"automatic-speech-recognition",
"whisper-event",
"generated_from_trainer",
"tr",
"dataset:mozilla-foundation/common_voice_17",
"base_model:openai/whisper-large-v2",
"license:apache-2.0",
"model-index",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:01:17+00:00 | [] | [
"tr"
] | TAGS
#transformers #tensorboard #safetensors #whisper #automatic-speech-recognition #whisper-event #generated_from_trainer #tr #dataset-mozilla-foundation/common_voice_17 #base_model-openai/whisper-large-v2 #license-apache-2.0 #model-index #endpoints_compatible #region-us
| Whisper Large v2 TR
===================
This model is a fine-tuned version of openai/whisper-large-v2 on the Common Voice 17 dataset.
It achieves the following results on the evaluation set:
* Loss: 0.1568
* Wer: 9.0189
Model description
-----------------
More information needed
Intended uses & limitations
---------------------------
More information needed
Training and evaluation data
----------------------------
More information needed
Training procedure
------------------
### Training hyperparameters
The following hyperparameters were used during training:
* learning\_rate: 1e-05
* train\_batch\_size: 16
* eval\_batch\_size: 16
* seed: 42
* gradient\_accumulation\_steps: 2
* total\_train\_batch\_size: 32
* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
* lr\_scheduler\_type: linear
* lr\_scheduler\_warmup\_ratio: 0.1
* num\_epochs: 3
* mixed\_precision\_training: Native AMP
### Training results
### Framework versions
* Transformers 4.40.0
* Pytorch 2.2.2+cu121
* Datasets 2.17.1
* Tokenizers 0.19.1
| [
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 1e-05\n* train\\_batch\\_size: 16\n* eval\\_batch\\_size: 16\n* seed: 42\n* gradient\\_accumulation\\_steps: 2\n* total\\_train\\_batch\\_size: 32\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: linear\n* lr\\_scheduler\\_warmup\\_ratio: 0.1\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.40.0\n* Pytorch 2.2.2+cu121\n* Datasets 2.17.1\n* Tokenizers 0.19.1"
] | [
"TAGS\n#transformers #tensorboard #safetensors #whisper #automatic-speech-recognition #whisper-event #generated_from_trainer #tr #dataset-mozilla-foundation/common_voice_17 #base_model-openai/whisper-large-v2 #license-apache-2.0 #model-index #endpoints_compatible #region-us \n",
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 1e-05\n* train\\_batch\\_size: 16\n* eval\\_batch\\_size: 16\n* seed: 42\n* gradient\\_accumulation\\_steps: 2\n* total\\_train\\_batch\\_size: 32\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: linear\n* lr\\_scheduler\\_warmup\\_ratio: 0.1\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.40.0\n* Pytorch 2.2.2+cu121\n* Datasets 2.17.1\n* Tokenizers 0.19.1"
] |
null | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | tenzintridhe/phi2-model-D | null | [
"transformers",
"safetensors",
"arxiv:1910.09700",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:02:39+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #arxiv-1910.09700 #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #arxiv-1910.09700 #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers |
# Uploaded model
- **Developed by:** zz-xx
- **License:** apache-2.0
- **Finetuned from model :** unsloth/gemma-7b-bnb-4bit
This gemma model was trained 2x faster with [Unsloth](https://github.com/unslothai/unsloth) and Huggingface's TRL library.
[<img src="https://raw.githubusercontent.com/unslothai/unsloth/main/images/unsloth%20made%20with%20love.png" width="200"/>](https://github.com/unslothai/unsloth)
| {"language": ["en"], "license": "apache-2.0", "tags": ["text-generation-inference", "transformers", "unsloth", "gemma", "trl", "sft"], "base_model": "unsloth/gemma-7b-bnb-4bit"} | zz-xx/gemma-7b-bnb-4bit-bias-merged-16-bit | null | [
"transformers",
"pytorch",
"gemma",
"text-generation",
"text-generation-inference",
"unsloth",
"trl",
"sft",
"en",
"base_model:unsloth/gemma-7b-bnb-4bit",
"license:apache-2.0",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:04:54+00:00 | [] | [
"en"
] | TAGS
#transformers #pytorch #gemma #text-generation #text-generation-inference #unsloth #trl #sft #en #base_model-unsloth/gemma-7b-bnb-4bit #license-apache-2.0 #autotrain_compatible #endpoints_compatible #region-us
|
# Uploaded model
- Developed by: zz-xx
- License: apache-2.0
- Finetuned from model : unsloth/gemma-7b-bnb-4bit
This gemma model was trained 2x faster with Unsloth and Huggingface's TRL library.
<img src="URL width="200"/>
| [
"# Uploaded model\n\n- Developed by: zz-xx\n- License: apache-2.0\n- Finetuned from model : unsloth/gemma-7b-bnb-4bit\n\nThis gemma model was trained 2x faster with Unsloth and Huggingface's TRL library.\n\n<img src=\"URL width=\"200\"/>"
] | [
"TAGS\n#transformers #pytorch #gemma #text-generation #text-generation-inference #unsloth #trl #sft #en #base_model-unsloth/gemma-7b-bnb-4bit #license-apache-2.0 #autotrain_compatible #endpoints_compatible #region-us \n",
"# Uploaded model\n\n- Developed by: zz-xx\n- License: apache-2.0\n- Finetuned from model : unsloth/gemma-7b-bnb-4bit\n\nThis gemma model was trained 2x faster with Unsloth and Huggingface's TRL library.\n\n<img src=\"URL width=\"200\"/>"
] |
text-classification | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed]
| {"library_name": "transformers", "tags": []} | nlpproject/IntentClassification_V1 | null | [
"transformers",
"safetensors",
"distilbert",
"text-classification",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:05:47+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #distilbert #text-classification #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #distilbert #text-classification #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
reinforcement-learning | stable-baselines3 |
# **DQN** Agent playing **SpaceInvadersNoFrameskip-v4**
This is a trained model of a **DQN** agent playing **SpaceInvadersNoFrameskip-v4**
using the [stable-baselines3 library](https://github.com/DLR-RM/stable-baselines3)
and the [RL Zoo](https://github.com/DLR-RM/rl-baselines3-zoo).
The RL Zoo is a training framework for Stable Baselines3
reinforcement learning agents,
with hyperparameter optimization and pre-trained agents included.
## Usage (with SB3 RL Zoo)
RL Zoo: https://github.com/DLR-RM/rl-baselines3-zoo<br/>
SB3: https://github.com/DLR-RM/stable-baselines3<br/>
SB3 Contrib: https://github.com/Stable-Baselines-Team/stable-baselines3-contrib
Install the RL Zoo (with SB3 and SB3-Contrib):
```bash
pip install rl_zoo3
```
```
# Download model and save it into the logs/ folder
python -m rl_zoo3.load_from_hub --algo dqn --env SpaceInvadersNoFrameskip-v4 -orga Edgar404 -f logs/
python -m rl_zoo3.enjoy --algo dqn --env SpaceInvadersNoFrameskip-v4 -f logs/
```
If you installed the RL Zoo3 via pip (`pip install rl_zoo3`), from anywhere you can do:
```
python -m rl_zoo3.load_from_hub --algo dqn --env SpaceInvadersNoFrameskip-v4 -orga Edgar404 -f logs/
python -m rl_zoo3.enjoy --algo dqn --env SpaceInvadersNoFrameskip-v4 -f logs/
```
## Training (with the RL Zoo)
```
python -m rl_zoo3.train --algo dqn --env SpaceInvadersNoFrameskip-v4 -f logs/
# Upload the model and generate video (when possible)
python -m rl_zoo3.push_to_hub --algo dqn --env SpaceInvadersNoFrameskip-v4 -f logs/ -orga Edgar404
```
## Hyperparameters
```python
OrderedDict([('batch_size', 32),
('buffer_size', 100000),
('env_wrapper',
['stable_baselines3.common.atari_wrappers.AtariWrapper']),
('exploration_final_eps', 0.01),
('exploration_fraction', 0.1),
('frame_stack', 4),
('gradient_steps', 1),
('learning_rate', 0.0001),
('learning_starts', 100000),
('n_timesteps', 1000000.0),
('optimize_memory_usage', False),
('policy', 'CnnPolicy'),
('target_update_interval', 1000),
('train_freq', 4),
('normalize', False)])
```
# Environment Arguments
```python
{'render_mode': 'rgb_array'}
```
| {"library_name": "stable-baselines3", "tags": ["SpaceInvadersNoFrameskip-v4", "deep-reinforcement-learning", "reinforcement-learning", "stable-baselines3"], "model-index": [{"name": "DQN", "results": [{"task": {"type": "reinforcement-learning", "name": "reinforcement-learning"}, "dataset": {"name": "SpaceInvadersNoFrameskip-v4", "type": "SpaceInvadersNoFrameskip-v4"}, "metrics": [{"type": "mean_reward", "value": "467.00 +/- 187.90", "name": "mean_reward", "verified": false}]}]}]} | Edgar404/dqn-SpaceInvadersNoFrameskip-v4 | null | [
"stable-baselines3",
"SpaceInvadersNoFrameskip-v4",
"deep-reinforcement-learning",
"reinforcement-learning",
"model-index",
"region:us"
] | null | 2024-04-28T21:11:07+00:00 | [] | [] | TAGS
#stable-baselines3 #SpaceInvadersNoFrameskip-v4 #deep-reinforcement-learning #reinforcement-learning #model-index #region-us
|
# DQN Agent playing SpaceInvadersNoFrameskip-v4
This is a trained model of a DQN agent playing SpaceInvadersNoFrameskip-v4
using the stable-baselines3 library
and the RL Zoo.
The RL Zoo is a training framework for Stable Baselines3
reinforcement learning agents,
with hyperparameter optimization and pre-trained agents included.
## Usage (with SB3 RL Zoo)
RL Zoo: URL
SB3: URL
SB3 Contrib: URL
Install the RL Zoo (with SB3 and SB3-Contrib):
If you installed the RL Zoo3 via pip ('pip install rl_zoo3'), from anywhere you can do:
## Training (with the RL Zoo)
## Hyperparameters
# Environment Arguments
| [
"# DQN Agent playing SpaceInvadersNoFrameskip-v4\nThis is a trained model of a DQN agent playing SpaceInvadersNoFrameskip-v4\nusing the stable-baselines3 library\nand the RL Zoo.\n\nThe RL Zoo is a training framework for Stable Baselines3\nreinforcement learning agents,\nwith hyperparameter optimization and pre-trained agents included.",
"## Usage (with SB3 RL Zoo)\n\nRL Zoo: URL\nSB3: URL\nSB3 Contrib: URL\n\nInstall the RL Zoo (with SB3 and SB3-Contrib):\n\n\n\n\nIf you installed the RL Zoo3 via pip ('pip install rl_zoo3'), from anywhere you can do:",
"## Training (with the RL Zoo)",
"## Hyperparameters",
"# Environment Arguments"
] | [
"TAGS\n#stable-baselines3 #SpaceInvadersNoFrameskip-v4 #deep-reinforcement-learning #reinforcement-learning #model-index #region-us \n",
"# DQN Agent playing SpaceInvadersNoFrameskip-v4\nThis is a trained model of a DQN agent playing SpaceInvadersNoFrameskip-v4\nusing the stable-baselines3 library\nand the RL Zoo.\n\nThe RL Zoo is a training framework for Stable Baselines3\nreinforcement learning agents,\nwith hyperparameter optimization and pre-trained agents included.",
"## Usage (with SB3 RL Zoo)\n\nRL Zoo: URL\nSB3: URL\nSB3 Contrib: URL\n\nInstall the RL Zoo (with SB3 and SB3-Contrib):\n\n\n\n\nIf you installed the RL Zoo3 via pip ('pip install rl_zoo3'), from anywhere you can do:",
"## Training (with the RL Zoo)",
"## Hyperparameters",
"# Environment Arguments"
] |
text-classification | transformers |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# xlnet-base-cased
This model was trained from scratch on an unknown dataset.
It achieves the following results on the evaluation set:
- Loss: 0.1940
- Rmse: 0.3007
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 5e-05
- train_batch_size: 16
- eval_batch_size: 8
- seed: 42
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: linear
- num_epochs: 10
### Training results
| Training Loss | Epoch | Step | Validation Loss | Rmse |
|:-------------:|:-----:|:----:|:---------------:|:------:|
| 0.2598 | 1.0 | 642 | 0.2309 | 0.3848 |
| 0.2498 | 2.0 | 1284 | 0.2335 | 0.3848 |
| 0.2475 | 3.0 | 1926 | 0.2343 | 0.3848 |
| 0.2399 | 4.0 | 2568 | 0.2197 | 0.3520 |
| 0.3899 | 5.0 | 3210 | 0.4305 | 0.3848 |
| 0.407 | 6.0 | 3852 | 0.3771 | 0.3548 |
| 0.3054 | 7.0 | 4494 | 0.2244 | 0.3548 |
| 0.2268 | 8.0 | 5136 | 0.2141 | 0.3542 |
| 0.2251 | 9.0 | 5778 | 0.2084 | 0.3165 |
| 0.1958 | 10.0 | 6420 | 0.1940 | 0.3007 |
### Framework versions
- Transformers 4.40.1
- Pytorch 2.0.1+cu117
- Datasets 2.18.0
- Tokenizers 0.19.1
| {"tags": ["generated_from_trainer"], "model-index": [{"name": "xlnet-base-cased", "results": []}]} | raulgdp/xlnet-base-cased | null | [
"transformers",
"tensorboard",
"safetensors",
"xlnet",
"text-classification",
"generated_from_trainer",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:11:39+00:00 | [] | [] | TAGS
#transformers #tensorboard #safetensors #xlnet #text-classification #generated_from_trainer #autotrain_compatible #endpoints_compatible #region-us
| xlnet-base-cased
================
This model was trained from scratch on an unknown dataset.
It achieves the following results on the evaluation set:
* Loss: 0.1940
* Rmse: 0.3007
Model description
-----------------
More information needed
Intended uses & limitations
---------------------------
More information needed
Training and evaluation data
----------------------------
More information needed
Training procedure
------------------
### Training hyperparameters
The following hyperparameters were used during training:
* learning\_rate: 5e-05
* train\_batch\_size: 16
* eval\_batch\_size: 8
* seed: 42
* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
* lr\_scheduler\_type: linear
* num\_epochs: 10
### Training results
### Framework versions
* Transformers 4.40.1
* Pytorch 2.0.1+cu117
* Datasets 2.18.0
* Tokenizers 0.19.1
| [
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 5e-05\n* train\\_batch\\_size: 16\n* eval\\_batch\\_size: 8\n* seed: 42\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: linear\n* num\\_epochs: 10",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.40.1\n* Pytorch 2.0.1+cu117\n* Datasets 2.18.0\n* Tokenizers 0.19.1"
] | [
"TAGS\n#transformers #tensorboard #safetensors #xlnet #text-classification #generated_from_trainer #autotrain_compatible #endpoints_compatible #region-us \n",
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 5e-05\n* train\\_batch\\_size: 16\n* eval\\_batch\\_size: 8\n* seed: 42\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: linear\n* num\\_epochs: 10",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.40.1\n* Pytorch 2.0.1+cu117\n* Datasets 2.18.0\n* Tokenizers 0.19.1"
] |
null | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | AkshayDiwadkar/mistral-sqlGPT-v0.0.1 | null | [
"transformers",
"safetensors",
"arxiv:1910.09700",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:12:00+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #arxiv-1910.09700 #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #arxiv-1910.09700 #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
null | peft |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# sqlGPT-ft-v0.0.1
This model is a fine-tuned version of [mistralai/Mistral-7B-v0.1](https://huggingface.co/mistralai/Mistral-7B-v0.1) on an unknown dataset.
It achieves the following results on the evaluation set:
- Loss: 0.3034
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 0.0002
- train_batch_size: 4
- eval_batch_size: 4
- seed: 42
- gradient_accumulation_steps: 4
- total_train_batch_size: 16
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: linear
- lr_scheduler_warmup_steps: 2
- num_epochs: 10
- mixed_precision_training: Native AMP
### Training results
| Training Loss | Epoch | Step | Validation Loss |
|:-------------:|:-----:|:----:|:---------------:|
| 0.4669 | 0.99 | 62 | 0.2490 |
| 0.1988 | 2.0 | 125 | 0.2304 |
| 0.1878 | 2.99 | 187 | 0.2280 |
| 0.1745 | 4.0 | 250 | 0.2314 |
| 0.1658 | 4.99 | 312 | 0.2361 |
| 0.1522 | 6.0 | 375 | 0.2459 |
| 0.1433 | 6.99 | 437 | 0.2606 |
| 0.1301 | 8.0 | 500 | 0.2788 |
| 0.1224 | 8.99 | 562 | 0.2948 |
| 0.1133 | 9.92 | 620 | 0.3034 |
### Framework versions
- PEFT 0.10.0
- Transformers 4.39.3
- Pytorch 2.1.2
- Datasets 2.18.0
- Tokenizers 0.15.2 | {"license": "apache-2.0", "library_name": "peft", "tags": ["generated_from_trainer"], "base_model": "mistralai/Mistral-7B-v0.1", "model-index": [{"name": "sqlGPT-ft-v0.0.1", "results": []}]} | AkshayDiwadkar/sqlGPT-ft-v0.0.1 | null | [
"peft",
"safetensors",
"generated_from_trainer",
"base_model:mistralai/Mistral-7B-v0.1",
"license:apache-2.0",
"region:us"
] | null | 2024-04-28T21:12:02+00:00 | [] | [] | TAGS
#peft #safetensors #generated_from_trainer #base_model-mistralai/Mistral-7B-v0.1 #license-apache-2.0 #region-us
| sqlGPT-ft-v0.0.1
================
This model is a fine-tuned version of mistralai/Mistral-7B-v0.1 on an unknown dataset.
It achieves the following results on the evaluation set:
* Loss: 0.3034
Model description
-----------------
More information needed
Intended uses & limitations
---------------------------
More information needed
Training and evaluation data
----------------------------
More information needed
Training procedure
------------------
### Training hyperparameters
The following hyperparameters were used during training:
* learning\_rate: 0.0002
* train\_batch\_size: 4
* eval\_batch\_size: 4
* seed: 42
* gradient\_accumulation\_steps: 4
* total\_train\_batch\_size: 16
* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
* lr\_scheduler\_type: linear
* lr\_scheduler\_warmup\_steps: 2
* num\_epochs: 10
* mixed\_precision\_training: Native AMP
### Training results
### Framework versions
* PEFT 0.10.0
* Transformers 4.39.3
* Pytorch 2.1.2
* Datasets 2.18.0
* Tokenizers 0.15.2
| [
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0002\n* train\\_batch\\_size: 4\n* eval\\_batch\\_size: 4\n* seed: 42\n* gradient\\_accumulation\\_steps: 4\n* total\\_train\\_batch\\_size: 16\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: linear\n* lr\\_scheduler\\_warmup\\_steps: 2\n* num\\_epochs: 10\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* PEFT 0.10.0\n* Transformers 4.39.3\n* Pytorch 2.1.2\n* Datasets 2.18.0\n* Tokenizers 0.15.2"
] | [
"TAGS\n#peft #safetensors #generated_from_trainer #base_model-mistralai/Mistral-7B-v0.1 #license-apache-2.0 #region-us \n",
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0002\n* train\\_batch\\_size: 4\n* eval\\_batch\\_size: 4\n* seed: 42\n* gradient\\_accumulation\\_steps: 4\n* total\\_train\\_batch\\_size: 16\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: linear\n* lr\\_scheduler\\_warmup\\_steps: 2\n* num\\_epochs: 10\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* PEFT 0.10.0\n* Transformers 4.39.3\n* Pytorch 2.1.2\n* Datasets 2.18.0\n* Tokenizers 0.15.2"
] |
feature-extraction | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | DRAGOO/model | null | [
"transformers",
"safetensors",
"bert",
"feature-extraction",
"arxiv:1910.09700",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:12:15+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #bert #feature-extraction #arxiv-1910.09700 #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #bert #feature-extraction #arxiv-1910.09700 #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
null | transformers | ## About
<!-- ### quantize_version: 2 -->
<!-- ### output_tensor_quantised: 1 -->
<!-- ### convert_type: -->
<!-- ### vocab_type: -->
static quants of https://huggingface.co/Tobistd/hypothesen-13b
<!-- provided-files -->
weighted/imatrix quants seem not to be available (by me) at this time. If they do not show up a week or so after the static ones, I have probably not planned for them. Feel free to request them by opening a Community Discussion.
## Usage
If you are unsure how to use GGUF files, refer to one of [TheBloke's
READMEs](https://huggingface.co/TheBloke/KafkaLM-70B-German-V0.1-GGUF) for
more details, including on how to concatenate multi-part files.
## Provided Quants
(sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants)
| Link | Type | Size/GB | Notes |
|:-----|:-----|--------:|:------|
| [GGUF](https://huggingface.co/mradermacher/hypothesen-13b-GGUF/resolve/main/hypothesen-13b.Q2_K.gguf) | Q2_K | 5.0 | |
| [GGUF](https://huggingface.co/mradermacher/hypothesen-13b-GGUF/resolve/main/hypothesen-13b.IQ3_XS.gguf) | IQ3_XS | 5.5 | |
| [GGUF](https://huggingface.co/mradermacher/hypothesen-13b-GGUF/resolve/main/hypothesen-13b.IQ3_S.gguf) | IQ3_S | 5.8 | beats Q3_K* |
| [GGUF](https://huggingface.co/mradermacher/hypothesen-13b-GGUF/resolve/main/hypothesen-13b.Q3_K_S.gguf) | Q3_K_S | 5.8 | |
| [GGUF](https://huggingface.co/mradermacher/hypothesen-13b-GGUF/resolve/main/hypothesen-13b.IQ3_M.gguf) | IQ3_M | 6.1 | |
| [GGUF](https://huggingface.co/mradermacher/hypothesen-13b-GGUF/resolve/main/hypothesen-13b.Q3_K_M.gguf) | Q3_K_M | 6.4 | lower quality |
| [GGUF](https://huggingface.co/mradermacher/hypothesen-13b-GGUF/resolve/main/hypothesen-13b.Q3_K_L.gguf) | Q3_K_L | 7.0 | |
| [GGUF](https://huggingface.co/mradermacher/hypothesen-13b-GGUF/resolve/main/hypothesen-13b.IQ4_XS.gguf) | IQ4_XS | 7.1 | |
| [GGUF](https://huggingface.co/mradermacher/hypothesen-13b-GGUF/resolve/main/hypothesen-13b.Q4_K_S.gguf) | Q4_K_S | 7.5 | fast, recommended |
| [GGUF](https://huggingface.co/mradermacher/hypothesen-13b-GGUF/resolve/main/hypothesen-13b.Q4_K_M.gguf) | Q4_K_M | 8.0 | fast, recommended |
| [GGUF](https://huggingface.co/mradermacher/hypothesen-13b-GGUF/resolve/main/hypothesen-13b.Q5_K_S.gguf) | Q5_K_S | 9.1 | |
| [GGUF](https://huggingface.co/mradermacher/hypothesen-13b-GGUF/resolve/main/hypothesen-13b.Q5_K_M.gguf) | Q5_K_M | 9.3 | |
| [GGUF](https://huggingface.co/mradermacher/hypothesen-13b-GGUF/resolve/main/hypothesen-13b.Q6_K.gguf) | Q6_K | 10.8 | very good quality |
| [GGUF](https://huggingface.co/mradermacher/hypothesen-13b-GGUF/resolve/main/hypothesen-13b.Q8_0.gguf) | Q8_0 | 13.9 | fast, best quality |
Here is a handy graph by ikawrakow comparing some lower-quality quant
types (lower is better):

And here are Artefact2's thoughts on the matter:
https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9
## FAQ / Model Request
See https://huggingface.co/mradermacher/model_requests for some answers to
questions you might have and/or if you want some other model quantized.
## Thanks
I thank my company, [nethype GmbH](https://www.nethype.de/), for letting
me use its servers and providing upgrades to my workstation to enable
this work in my free time.
<!-- end -->
| {"language": ["en"], "library_name": "transformers", "tags": [], "base_model": "Tobistd/hypothesen-13b", "quantized_by": "mradermacher"} | mradermacher/hypothesen-13b-GGUF | null | [
"transformers",
"gguf",
"en",
"base_model:Tobistd/hypothesen-13b",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:13:57+00:00 | [] | [
"en"
] | TAGS
#transformers #gguf #en #base_model-Tobistd/hypothesen-13b #endpoints_compatible #region-us
| About
-----
static quants of URL
weighted/imatrix quants seem not to be available (by me) at this time. If they do not show up a week or so after the static ones, I have probably not planned for them. Feel free to request them by opening a Community Discussion.
Usage
-----
If you are unsure how to use GGUF files, refer to one of TheBloke's
READMEs for
more details, including on how to concatenate multi-part files.
Provided Quants
---------------
(sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants)
Here is a handy graph by ikawrakow comparing some lower-quality quant
types (lower is better):
!URL
And here are Artefact2's thoughts on the matter:
URL
FAQ / Model Request
-------------------
See URL for some answers to
questions you might have and/or if you want some other model quantized.
Thanks
------
I thank my company, nethype GmbH, for letting
me use its servers and providing upgrades to my workstation to enable
this work in my free time.
| [] | [
"TAGS\n#transformers #gguf #en #base_model-Tobistd/hypothesen-13b #endpoints_compatible #region-us \n"
] |
null | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | Aaron82352/length_generalization_testing_ABC_200steps | null | [
"transformers",
"safetensors",
"arxiv:1910.09700",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:14:06+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #arxiv-1910.09700 #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #arxiv-1910.09700 #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
null | transformers | ## About
<!-- ### quantize_version: 2 -->
<!-- ### output_tensor_quantised: 1 -->
<!-- ### convert_type: -->
<!-- ### vocab_type: -->
static quants of https://huggingface.co/lodrick-the-lafted/Olethros-8B
<!-- provided-files -->
weighted/imatrix quants seem not to be available (by me) at this time. If they do not show up a week or so after the static ones, I have probably not planned for them. Feel free to request them by opening a Community Discussion.
## Usage
If you are unsure how to use GGUF files, refer to one of [TheBloke's
READMEs](https://huggingface.co/TheBloke/KafkaLM-70B-German-V0.1-GGUF) for
more details, including on how to concatenate multi-part files.
## Provided Quants
(sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants)
| Link | Type | Size/GB | Notes |
|:-----|:-----|--------:|:------|
| [GGUF](https://huggingface.co/mradermacher/Olethros-8B-GGUF/resolve/main/Olethros-8B.Q2_K.gguf) | Q2_K | 3.3 | |
| [GGUF](https://huggingface.co/mradermacher/Olethros-8B-GGUF/resolve/main/Olethros-8B.IQ3_XS.gguf) | IQ3_XS | 3.6 | |
| [GGUF](https://huggingface.co/mradermacher/Olethros-8B-GGUF/resolve/main/Olethros-8B.Q3_K_S.gguf) | Q3_K_S | 3.8 | |
| [GGUF](https://huggingface.co/mradermacher/Olethros-8B-GGUF/resolve/main/Olethros-8B.IQ3_S.gguf) | IQ3_S | 3.8 | beats Q3_K* |
| [GGUF](https://huggingface.co/mradermacher/Olethros-8B-GGUF/resolve/main/Olethros-8B.IQ3_M.gguf) | IQ3_M | 3.9 | |
| [GGUF](https://huggingface.co/mradermacher/Olethros-8B-GGUF/resolve/main/Olethros-8B.Q3_K_M.gguf) | Q3_K_M | 4.1 | lower quality |
| [GGUF](https://huggingface.co/mradermacher/Olethros-8B-GGUF/resolve/main/Olethros-8B.Q3_K_L.gguf) | Q3_K_L | 4.4 | |
| [GGUF](https://huggingface.co/mradermacher/Olethros-8B-GGUF/resolve/main/Olethros-8B.IQ4_XS.gguf) | IQ4_XS | 4.6 | |
| [GGUF](https://huggingface.co/mradermacher/Olethros-8B-GGUF/resolve/main/Olethros-8B.Q4_K_S.gguf) | Q4_K_S | 4.8 | fast, recommended |
| [GGUF](https://huggingface.co/mradermacher/Olethros-8B-GGUF/resolve/main/Olethros-8B.Q4_K_M.gguf) | Q4_K_M | 5.0 | fast, recommended |
| [GGUF](https://huggingface.co/mradermacher/Olethros-8B-GGUF/resolve/main/Olethros-8B.Q5_K_S.gguf) | Q5_K_S | 5.7 | |
| [GGUF](https://huggingface.co/mradermacher/Olethros-8B-GGUF/resolve/main/Olethros-8B.Q5_K_M.gguf) | Q5_K_M | 5.8 | |
| [GGUF](https://huggingface.co/mradermacher/Olethros-8B-GGUF/resolve/main/Olethros-8B.Q6_K.gguf) | Q6_K | 6.7 | very good quality |
| [GGUF](https://huggingface.co/mradermacher/Olethros-8B-GGUF/resolve/main/Olethros-8B.Q8_0.gguf) | Q8_0 | 8.6 | fast, best quality |
| [GGUF](https://huggingface.co/mradermacher/Olethros-8B-GGUF/resolve/main/Olethros-8B.f16.gguf) | f16 | 16.2 | 16 bpw, overkill |
Here is a handy graph by ikawrakow comparing some lower-quality quant
types (lower is better):

And here are Artefact2's thoughts on the matter:
https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9
## FAQ / Model Request
See https://huggingface.co/mradermacher/model_requests for some answers to
questions you might have and/or if you want some other model quantized.
## Thanks
I thank my company, [nethype GmbH](https://www.nethype.de/), for letting
me use its servers and providing upgrades to my workstation to enable
this work in my free time.
<!-- end -->
| {"language": ["en"], "license": "llama3", "library_name": "transformers", "datasets": ["lodrick-the-lafted/OpusStories", "lodrick-the-lafted/Sao10K_Claude-3-Opus-Instruct-3.3K", "lodrick-the-lafted/Samantha-Opus", "lodrick-the-lafted/Worldsim-Opus"], "base_model": "lodrick-the-lafted/Olethros-8B", "quantized_by": "mradermacher"} | mradermacher/Olethros-8B-GGUF | null | [
"transformers",
"gguf",
"en",
"dataset:lodrick-the-lafted/OpusStories",
"dataset:lodrick-the-lafted/Sao10K_Claude-3-Opus-Instruct-3.3K",
"dataset:lodrick-the-lafted/Samantha-Opus",
"dataset:lodrick-the-lafted/Worldsim-Opus",
"base_model:lodrick-the-lafted/Olethros-8B",
"license:llama3",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:14:23+00:00 | [] | [
"en"
] | TAGS
#transformers #gguf #en #dataset-lodrick-the-lafted/OpusStories #dataset-lodrick-the-lafted/Sao10K_Claude-3-Opus-Instruct-3.3K #dataset-lodrick-the-lafted/Samantha-Opus #dataset-lodrick-the-lafted/Worldsim-Opus #base_model-lodrick-the-lafted/Olethros-8B #license-llama3 #endpoints_compatible #region-us
| About
-----
static quants of URL
weighted/imatrix quants seem not to be available (by me) at this time. If they do not show up a week or so after the static ones, I have probably not planned for them. Feel free to request them by opening a Community Discussion.
Usage
-----
If you are unsure how to use GGUF files, refer to one of TheBloke's
READMEs for
more details, including on how to concatenate multi-part files.
Provided Quants
---------------
(sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants)
Here is a handy graph by ikawrakow comparing some lower-quality quant
types (lower is better):
!URL
And here are Artefact2's thoughts on the matter:
URL
FAQ / Model Request
-------------------
See URL for some answers to
questions you might have and/or if you want some other model quantized.
Thanks
------
I thank my company, nethype GmbH, for letting
me use its servers and providing upgrades to my workstation to enable
this work in my free time.
| [] | [
"TAGS\n#transformers #gguf #en #dataset-lodrick-the-lafted/OpusStories #dataset-lodrick-the-lafted/Sao10K_Claude-3-Opus-Instruct-3.3K #dataset-lodrick-the-lafted/Samantha-Opus #dataset-lodrick-the-lafted/Worldsim-Opus #base_model-lodrick-the-lafted/Olethros-8B #license-llama3 #endpoints_compatible #region-us \n"
] |
null | transformers | ## About
<!-- ### quantize_version: 2 -->
<!-- ### output_tensor_quantised: 1 -->
<!-- ### convert_type: -->
<!-- ### vocab_type: -->
static quants of https://huggingface.co/TETO101/AIRI-8B-V3
<!-- provided-files -->
weighted/imatrix quants seem not to be available (by me) at this time. If they do not show up a week or so after the static ones, I have probably not planned for them. Feel free to request them by opening a Community Discussion.
## Usage
If you are unsure how to use GGUF files, refer to one of [TheBloke's
READMEs](https://huggingface.co/TheBloke/KafkaLM-70B-German-V0.1-GGUF) for
more details, including on how to concatenate multi-part files.
## Provided Quants
(sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants)
| Link | Type | Size/GB | Notes |
|:-----|:-----|--------:|:------|
| [GGUF](https://huggingface.co/mradermacher/AIRI-8B-V3-GGUF/resolve/main/AIRI-8B-V3.Q2_K.gguf) | Q2_K | 3.3 | |
| [GGUF](https://huggingface.co/mradermacher/AIRI-8B-V3-GGUF/resolve/main/AIRI-8B-V3.IQ3_XS.gguf) | IQ3_XS | 3.6 | |
| [GGUF](https://huggingface.co/mradermacher/AIRI-8B-V3-GGUF/resolve/main/AIRI-8B-V3.Q3_K_S.gguf) | Q3_K_S | 3.8 | |
| [GGUF](https://huggingface.co/mradermacher/AIRI-8B-V3-GGUF/resolve/main/AIRI-8B-V3.IQ3_S.gguf) | IQ3_S | 3.8 | beats Q3_K* |
| [GGUF](https://huggingface.co/mradermacher/AIRI-8B-V3-GGUF/resolve/main/AIRI-8B-V3.IQ3_M.gguf) | IQ3_M | 3.9 | |
| [GGUF](https://huggingface.co/mradermacher/AIRI-8B-V3-GGUF/resolve/main/AIRI-8B-V3.Q3_K_M.gguf) | Q3_K_M | 4.1 | lower quality |
| [GGUF](https://huggingface.co/mradermacher/AIRI-8B-V3-GGUF/resolve/main/AIRI-8B-V3.Q3_K_L.gguf) | Q3_K_L | 4.4 | |
| [GGUF](https://huggingface.co/mradermacher/AIRI-8B-V3-GGUF/resolve/main/AIRI-8B-V3.IQ4_XS.gguf) | IQ4_XS | 4.6 | |
| [GGUF](https://huggingface.co/mradermacher/AIRI-8B-V3-GGUF/resolve/main/AIRI-8B-V3.Q4_K_S.gguf) | Q4_K_S | 4.8 | fast, recommended |
| [GGUF](https://huggingface.co/mradermacher/AIRI-8B-V3-GGUF/resolve/main/AIRI-8B-V3.Q4_K_M.gguf) | Q4_K_M | 5.0 | fast, recommended |
| [GGUF](https://huggingface.co/mradermacher/AIRI-8B-V3-GGUF/resolve/main/AIRI-8B-V3.Q5_K_S.gguf) | Q5_K_S | 5.7 | |
| [GGUF](https://huggingface.co/mradermacher/AIRI-8B-V3-GGUF/resolve/main/AIRI-8B-V3.Q5_K_M.gguf) | Q5_K_M | 5.8 | |
| [GGUF](https://huggingface.co/mradermacher/AIRI-8B-V3-GGUF/resolve/main/AIRI-8B-V3.Q6_K.gguf) | Q6_K | 6.7 | very good quality |
| [GGUF](https://huggingface.co/mradermacher/AIRI-8B-V3-GGUF/resolve/main/AIRI-8B-V3.Q8_0.gguf) | Q8_0 | 8.6 | fast, best quality |
| [GGUF](https://huggingface.co/mradermacher/AIRI-8B-V3-GGUF/resolve/main/AIRI-8B-V3.f16.gguf) | f16 | 16.2 | 16 bpw, overkill |
Here is a handy graph by ikawrakow comparing some lower-quality quant
types (lower is better):

And here are Artefact2's thoughts on the matter:
https://gist.github.com/Artefact2/b5f810600771265fc1e39442288e8ec9
## FAQ / Model Request
See https://huggingface.co/mradermacher/model_requests for some answers to
questions you might have and/or if you want some other model quantized.
## Thanks
I thank my company, [nethype GmbH](https://www.nethype.de/), for letting
me use its servers and providing upgrades to my workstation to enable
this work in my free time.
<!-- end -->
| {"language": ["en"], "license": "apache-2.0", "library_name": "transformers", "tags": ["text-generation-inference", "transformers", "unsloth", "llama", "trl", "sft"], "base_model": "TETO101/AIRI-8B-V3", "quantized_by": "mradermacher"} | mradermacher/AIRI-8B-V3-GGUF | null | [
"transformers",
"gguf",
"text-generation-inference",
"unsloth",
"llama",
"trl",
"sft",
"en",
"base_model:TETO101/AIRI-8B-V3",
"license:apache-2.0",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:14:31+00:00 | [] | [
"en"
] | TAGS
#transformers #gguf #text-generation-inference #unsloth #llama #trl #sft #en #base_model-TETO101/AIRI-8B-V3 #license-apache-2.0 #endpoints_compatible #region-us
| About
-----
static quants of URL
weighted/imatrix quants seem not to be available (by me) at this time. If they do not show up a week or so after the static ones, I have probably not planned for them. Feel free to request them by opening a Community Discussion.
Usage
-----
If you are unsure how to use GGUF files, refer to one of TheBloke's
READMEs for
more details, including on how to concatenate multi-part files.
Provided Quants
---------------
(sorted by size, not necessarily quality. IQ-quants are often preferable over similar sized non-IQ quants)
Here is a handy graph by ikawrakow comparing some lower-quality quant
types (lower is better):
!URL
And here are Artefact2's thoughts on the matter:
URL
FAQ / Model Request
-------------------
See URL for some answers to
questions you might have and/or if you want some other model quantized.
Thanks
------
I thank my company, nethype GmbH, for letting
me use its servers and providing upgrades to my workstation to enable
this work in my free time.
| [] | [
"TAGS\n#transformers #gguf #text-generation-inference #unsloth #llama #trl #sft #en #base_model-TETO101/AIRI-8B-V3 #license-apache-2.0 #endpoints_compatible #region-us \n"
] |
text-classification | transformers |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# salfo-test-trainer
This model is a fine-tuned version of [bert-base-uncased](https://huggingface.co/bert-base-uncased) on an unknown dataset.
It achieves the following results on the evaluation set:
- Loss: 0.4837
- Accuracy: 0.8382
- F1: 0.8866
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 5e-05
- train_batch_size: 8
- eval_batch_size: 8
- seed: 42
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: linear
- num_epochs: 3.0
### Training results
| Training Loss | Epoch | Step | Validation Loss | Accuracy | F1 |
|:-------------:|:-----:|:----:|:---------------:|:--------:|:------:|
| No log | 1.0 | 459 | 0.5474 | 0.7059 | 0.8198 |
| 0.6259 | 2.0 | 918 | 0.4626 | 0.8137 | 0.8690 |
| 0.5063 | 3.0 | 1377 | 0.4837 | 0.8382 | 0.8866 |
### Framework versions
- Transformers 4.40.0
- Pytorch 2.2.1+cu121
- Datasets 2.19.0
- Tokenizers 0.19.1
| {"license": "apache-2.0", "tags": ["generated_from_trainer"], "metrics": ["accuracy", "f1"], "base_model": "bert-base-uncased", "model-index": [{"name": "salfo-test-trainer", "results": []}]} | Salfo/salfo-test-trainer | null | [
"transformers",
"tensorboard",
"safetensors",
"bert",
"text-classification",
"generated_from_trainer",
"base_model:bert-base-uncased",
"license:apache-2.0",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:16:26+00:00 | [] | [] | TAGS
#transformers #tensorboard #safetensors #bert #text-classification #generated_from_trainer #base_model-bert-base-uncased #license-apache-2.0 #autotrain_compatible #endpoints_compatible #region-us
| salfo-test-trainer
==================
This model is a fine-tuned version of bert-base-uncased on an unknown dataset.
It achieves the following results on the evaluation set:
* Loss: 0.4837
* Accuracy: 0.8382
* F1: 0.8866
Model description
-----------------
More information needed
Intended uses & limitations
---------------------------
More information needed
Training and evaluation data
----------------------------
More information needed
Training procedure
------------------
### Training hyperparameters
The following hyperparameters were used during training:
* learning\_rate: 5e-05
* train\_batch\_size: 8
* eval\_batch\_size: 8
* seed: 42
* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
* lr\_scheduler\_type: linear
* num\_epochs: 3.0
### Training results
### Framework versions
* Transformers 4.40.0
* Pytorch 2.2.1+cu121
* Datasets 2.19.0
* Tokenizers 0.19.1
| [
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 5e-05\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: linear\n* num\\_epochs: 3.0",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.40.0\n* Pytorch 2.2.1+cu121\n* Datasets 2.19.0\n* Tokenizers 0.19.1"
] | [
"TAGS\n#transformers #tensorboard #safetensors #bert #text-classification #generated_from_trainer #base_model-bert-base-uncased #license-apache-2.0 #autotrain_compatible #endpoints_compatible #region-us \n",
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 5e-05\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: linear\n* num\\_epochs: 3.0",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.40.0\n* Pytorch 2.2.1+cu121\n* Datasets 2.19.0\n* Tokenizers 0.19.1"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | golf2248/cwzyy8h | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T21:16:29+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | shallow6414/u26t37c | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T21:18:47+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | OwOOwO/finalc | null | [
"transformers",
"safetensors",
"stablelm",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:19:52+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #stablelm #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #stablelm #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers |
# InnerI-bittensor-7b
InnerI-bittensor-7b is a merge of the following models using [LazyMergekit](https://colab.research.google.com/drive/1obulZ1ROXHjYLn6PPZJwRR6GzgQogxxb?usp=sharing):
* [InnerI/A-I-0xtom-7B-slerp](https://huggingface.co/InnerI/A-I-0xtom-7B-slerp)
* [gowhyyou/bittensor-finetuning](https://huggingface.co/gowhyyou/bittensor-finetuning)
## 🧩 Configuration
```yaml
slices:
- sources:
- model: InnerI/A-I-0xtom-7B-slerp
layer_range: [0, 32]
- model: gowhyyou/bittensor-finetuning
layer_range: [0, 32]
merge_method: slerp
base_model: InnerI/A-I-0xtom-7B-slerp
parameters:
t:
- filter: self_attn
value: [0, 0.5, 0.3, 0.7, 1]
- filter: mlp
value: [1, 0.5, 0.7, 0.3, 0]
- value: 0.5
dtype: bfloat16
```
## 💻 Usage
```python
!pip install -qU transformers accelerate
from transformers import AutoTokenizer
import transformers
import torch
model = "InnerI/InnerI-bittensor-7b"
messages = [{"role": "user", "content": "What is a large language model?"}]
tokenizer = AutoTokenizer.from_pretrained(model)
prompt = tokenizer.apply_chat_template(messages, tokenize=False, add_generation_prompt=True)
pipeline = transformers.pipeline(
"text-generation",
model=model,
torch_dtype=torch.float16,
device_map="auto",
)
outputs = pipeline(prompt, max_new_tokens=256, do_sample=True, temperature=0.7, top_k=50, top_p=0.95)
print(outputs[0]["generated_text"])
``` | {"tags": ["merge", "mergekit", "lazymergekit", "InnerI/A-I-0xtom-7B-slerp", "gowhyyou/bittensor-finetuning"], "base_model": ["InnerI/A-I-0xtom-7B-slerp", "gowhyyou/bittensor-finetuning"]} | InnerI/InnerI-bittensor-7b | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"merge",
"mergekit",
"lazymergekit",
"InnerI/A-I-0xtom-7B-slerp",
"gowhyyou/bittensor-finetuning",
"conversational",
"base_model:InnerI/A-I-0xtom-7B-slerp",
"base_model:gowhyyou/bittensor-finetuning",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T21:20:07+00:00 | [] | [] | TAGS
#transformers #safetensors #llama #text-generation #merge #mergekit #lazymergekit #InnerI/A-I-0xtom-7B-slerp #gowhyyou/bittensor-finetuning #conversational #base_model-InnerI/A-I-0xtom-7B-slerp #base_model-gowhyyou/bittensor-finetuning #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
|
# InnerI-bittensor-7b
InnerI-bittensor-7b is a merge of the following models using LazyMergekit:
* InnerI/A-I-0xtom-7B-slerp
* gowhyyou/bittensor-finetuning
## Configuration
## Usage
| [
"# InnerI-bittensor-7b\n\nInnerI-bittensor-7b is a merge of the following models using LazyMergekit:\n* InnerI/A-I-0xtom-7B-slerp\n* gowhyyou/bittensor-finetuning",
"## Configuration",
"## Usage"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #merge #mergekit #lazymergekit #InnerI/A-I-0xtom-7B-slerp #gowhyyou/bittensor-finetuning #conversational #base_model-InnerI/A-I-0xtom-7B-slerp #base_model-gowhyyou/bittensor-finetuning #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# InnerI-bittensor-7b\n\nInnerI-bittensor-7b is a merge of the following models using LazyMergekit:\n* InnerI/A-I-0xtom-7B-slerp\n* gowhyyou/bittensor-finetuning",
"## Configuration",
"## Usage"
] |
null | null |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# G0428HMA11
This model is a fine-tuned version of [google/gemma-2b](https://huggingface.co/google/gemma-2b) on an unknown dataset.
It achieves the following results on the evaluation set:
- Loss: 0.1108
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 0.0003
- train_batch_size: 8
- eval_batch_size: 8
- seed: 42
- gradient_accumulation_steps: 16
- total_train_batch_size: 128
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: cosine_with_restarts
- lr_scheduler_warmup_steps: 100
- num_epochs: 3
- mixed_precision_training: Native AMP
### Training results
| Training Loss | Epoch | Step | Validation Loss |
|:-------------:|:-----:|:----:|:---------------:|
| 2.7848 | 0.09 | 10 | 2.0338 |
| 1.5344 | 0.18 | 20 | 0.9449 |
| 0.5532 | 0.27 | 30 | 0.2231 |
| 0.1757 | 0.36 | 40 | 0.1577 |
| 0.151 | 0.45 | 50 | 0.1493 |
| 0.149 | 0.54 | 60 | 0.1492 |
| 0.1476 | 0.63 | 70 | 0.1472 |
| 0.1488 | 0.73 | 80 | 0.1479 |
| 0.1416 | 0.82 | 90 | 0.1485 |
| 0.1452 | 0.91 | 100 | 0.1475 |
| 0.1484 | 1.0 | 110 | 0.1486 |
| 0.1431 | 1.09 | 120 | 0.1476 |
| 0.1447 | 1.18 | 130 | 0.1481 |
| 0.1451 | 1.27 | 140 | 0.1469 |
| 0.1474 | 1.36 | 150 | 0.1455 |
| 0.1417 | 1.45 | 160 | 0.1463 |
| 0.1428 | 1.54 | 170 | 0.1426 |
| 0.1406 | 1.63 | 180 | 0.1370 |
| 0.1392 | 1.72 | 190 | 0.1435 |
| 0.1355 | 1.81 | 200 | 0.1343 |
| 0.1343 | 1.9 | 210 | 0.1318 |
| 0.1297 | 1.99 | 220 | 0.1237 |
| 0.1205 | 2.08 | 230 | 0.1239 |
| 0.1161 | 2.18 | 240 | 0.1210 |
| 0.1139 | 2.27 | 250 | 0.1177 |
| 0.1159 | 2.36 | 260 | 0.1159 |
| 0.1165 | 2.45 | 270 | 0.1150 |
| 0.111 | 2.54 | 280 | 0.1146 |
| 0.1049 | 2.63 | 290 | 0.1129 |
| 0.1055 | 2.72 | 300 | 0.1116 |
| 0.1108 | 2.81 | 310 | 0.1112 |
| 0.1117 | 2.9 | 320 | 0.1109 |
| 0.1116 | 2.99 | 330 | 0.1108 |
### Framework versions
- Transformers 4.36.0.dev0
- Pytorch 2.1.2+cu121
- Datasets 2.14.6
- Tokenizers 0.14.1
| {"license": "gemma", "tags": ["generated_from_trainer"], "base_model": "google/gemma-2b", "model-index": [{"name": "G0428HMA11", "results": []}]} | Litzy619/G0428HMA11 | null | [
"safetensors",
"generated_from_trainer",
"base_model:google/gemma-2b",
"license:gemma",
"region:us"
] | null | 2024-04-28T21:21:27+00:00 | [] | [] | TAGS
#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us
| G0428HMA11
==========
This model is a fine-tuned version of google/gemma-2b on an unknown dataset.
It achieves the following results on the evaluation set:
* Loss: 0.1108
Model description
-----------------
More information needed
Intended uses & limitations
---------------------------
More information needed
Training and evaluation data
----------------------------
More information needed
Training procedure
------------------
### Training hyperparameters
The following hyperparameters were used during training:
* learning\_rate: 0.0003
* train\_batch\_size: 8
* eval\_batch\_size: 8
* seed: 42
* gradient\_accumulation\_steps: 16
* total\_train\_batch\_size: 128
* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
* lr\_scheduler\_type: cosine\_with\_restarts
* lr\_scheduler\_warmup\_steps: 100
* num\_epochs: 3
* mixed\_precision\_training: Native AMP
### Training results
### Framework versions
* Transformers 4.36.0.dev0
* Pytorch 2.1.2+cu121
* Datasets 2.14.6
* Tokenizers 0.14.1
| [
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 100\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] | [
"TAGS\n#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us \n",
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 100\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] |
null | null |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# G0428HMA12
This model is a fine-tuned version of [google/gemma-2b](https://huggingface.co/google/gemma-2b) on an unknown dataset.
It achieves the following results on the evaluation set:
- Loss: 0.1027
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 0.0003
- train_batch_size: 8
- eval_batch_size: 8
- seed: 42
- gradient_accumulation_steps: 16
- total_train_batch_size: 128
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: cosine_with_restarts
- lr_scheduler_warmup_steps: 100
- num_epochs: 3
- mixed_precision_training: Native AMP
### Training results
| Training Loss | Epoch | Step | Validation Loss |
|:-------------:|:-----:|:----:|:---------------:|
| 2.7107 | 0.09 | 10 | 1.8639 |
| 1.2972 | 0.18 | 20 | 0.6487 |
| 0.3487 | 0.27 | 30 | 0.1841 |
| 0.1607 | 0.36 | 40 | 0.1546 |
| 0.1485 | 0.45 | 50 | 0.1486 |
| 0.1502 | 0.54 | 60 | 0.1479 |
| 0.1489 | 0.63 | 70 | 0.1473 |
| 0.1499 | 0.73 | 80 | 0.1478 |
| 0.1422 | 0.82 | 90 | 0.1468 |
| 0.1456 | 0.91 | 100 | 0.1473 |
| 0.1488 | 1.0 | 110 | 0.1490 |
| 0.1431 | 1.09 | 120 | 0.1472 |
| 0.1431 | 1.18 | 130 | 0.1476 |
| 0.1439 | 1.27 | 140 | 0.1411 |
| 0.1413 | 1.36 | 150 | 0.1333 |
| 0.1335 | 1.45 | 160 | 0.1405 |
| 0.1356 | 1.54 | 170 | 0.1308 |
| 0.1266 | 1.63 | 180 | 0.1265 |
| 0.124 | 1.72 | 190 | 0.1253 |
| 0.1202 | 1.81 | 200 | 0.1205 |
| 0.1211 | 1.9 | 210 | 0.1202 |
| 0.1218 | 1.99 | 220 | 0.1167 |
| 0.107 | 2.08 | 230 | 0.1134 |
| 0.1026 | 2.18 | 240 | 0.1116 |
| 0.1024 | 2.27 | 250 | 0.1094 |
| 0.1036 | 2.36 | 260 | 0.1076 |
| 0.1026 | 2.45 | 270 | 0.1052 |
| 0.099 | 2.54 | 280 | 0.1045 |
| 0.0891 | 2.63 | 290 | 0.1047 |
| 0.0949 | 2.72 | 300 | 0.1042 |
| 0.0974 | 2.81 | 310 | 0.1031 |
| 0.0992 | 2.9 | 320 | 0.1028 |
| 0.1024 | 2.99 | 330 | 0.1027 |
### Framework versions
- Transformers 4.36.0.dev0
- Pytorch 2.1.2+cu121
- Datasets 2.14.6
- Tokenizers 0.14.1
| {"license": "gemma", "tags": ["generated_from_trainer"], "base_model": "google/gemma-2b", "model-index": [{"name": "G0428HMA12", "results": []}]} | Litzy619/G0428HMA12 | null | [
"safetensors",
"generated_from_trainer",
"base_model:google/gemma-2b",
"license:gemma",
"region:us"
] | null | 2024-04-28T21:21:42+00:00 | [] | [] | TAGS
#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us
| G0428HMA12
==========
This model is a fine-tuned version of google/gemma-2b on an unknown dataset.
It achieves the following results on the evaluation set:
* Loss: 0.1027
Model description
-----------------
More information needed
Intended uses & limitations
---------------------------
More information needed
Training and evaluation data
----------------------------
More information needed
Training procedure
------------------
### Training hyperparameters
The following hyperparameters were used during training:
* learning\_rate: 0.0003
* train\_batch\_size: 8
* eval\_batch\_size: 8
* seed: 42
* gradient\_accumulation\_steps: 16
* total\_train\_batch\_size: 128
* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
* lr\_scheduler\_type: cosine\_with\_restarts
* lr\_scheduler\_warmup\_steps: 100
* num\_epochs: 3
* mixed\_precision\_training: Native AMP
### Training results
### Framework versions
* Transformers 4.36.0.dev0
* Pytorch 2.1.2+cu121
* Datasets 2.14.6
* Tokenizers 0.14.1
| [
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 100\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] | [
"TAGS\n#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us \n",
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 100\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] |
null | null |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# G0428HMA13
This model is a fine-tuned version of [google/gemma-2b](https://huggingface.co/google/gemma-2b) on an unknown dataset.
It achieves the following results on the evaluation set:
- Loss: 0.1057
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 0.0003
- train_batch_size: 8
- eval_batch_size: 8
- seed: 42
- gradient_accumulation_steps: 16
- total_train_batch_size: 128
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: cosine_with_restarts
- lr_scheduler_warmup_steps: 100
- num_epochs: 3
- mixed_precision_training: Native AMP
### Training results
| Training Loss | Epoch | Step | Validation Loss |
|:-------------:|:-----:|:----:|:---------------:|
| 2.6372 | 0.09 | 10 | 1.7096 |
| 1.1238 | 0.18 | 20 | 0.4795 |
| 0.2595 | 0.27 | 30 | 0.1668 |
| 0.155 | 0.36 | 40 | 0.1603 |
| 0.1489 | 0.45 | 50 | 0.1483 |
| 0.1474 | 0.54 | 60 | 0.1499 |
| 0.1479 | 0.63 | 70 | 0.1470 |
| 0.1491 | 0.73 | 80 | 0.1479 |
| 0.1413 | 0.82 | 90 | 0.1486 |
| 0.1448 | 0.91 | 100 | 0.1479 |
| 0.1492 | 1.0 | 110 | 0.1488 |
| 0.1429 | 1.09 | 120 | 0.1485 |
| 0.1447 | 1.18 | 130 | 0.1485 |
| 0.146 | 1.27 | 140 | 0.1473 |
| 0.1478 | 1.36 | 150 | 0.1466 |
| 0.1423 | 1.45 | 160 | 0.1507 |
| 0.1434 | 1.54 | 170 | 0.1435 |
| 0.1392 | 1.63 | 180 | 0.1377 |
| 0.1379 | 1.72 | 190 | 0.1359 |
| 0.1285 | 1.81 | 200 | 0.1294 |
| 0.1271 | 1.9 | 210 | 0.1303 |
| 0.1269 | 1.99 | 220 | 0.1228 |
| 0.1118 | 2.08 | 230 | 0.1210 |
| 0.1144 | 2.18 | 240 | 0.1153 |
| 0.1106 | 2.27 | 250 | 0.1123 |
| 0.1116 | 2.36 | 260 | 0.1155 |
| 0.1158 | 2.45 | 270 | 0.1118 |
| 0.1066 | 2.54 | 280 | 0.1109 |
| 0.0991 | 2.63 | 290 | 0.1098 |
| 0.1016 | 2.72 | 300 | 0.1064 |
| 0.1029 | 2.81 | 310 | 0.1058 |
| 0.1052 | 2.9 | 320 | 0.1057 |
| 0.106 | 2.99 | 330 | 0.1057 |
### Framework versions
- Transformers 4.36.0.dev0
- Pytorch 2.1.2+cu121
- Datasets 2.14.6
- Tokenizers 0.14.1
| {"license": "gemma", "tags": ["generated_from_trainer"], "base_model": "google/gemma-2b", "model-index": [{"name": "G0428HMA13", "results": []}]} | Litzy619/G0428HMA13 | null | [
"safetensors",
"generated_from_trainer",
"base_model:google/gemma-2b",
"license:gemma",
"region:us"
] | null | 2024-04-28T21:22:25+00:00 | [] | [] | TAGS
#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us
| G0428HMA13
==========
This model is a fine-tuned version of google/gemma-2b on an unknown dataset.
It achieves the following results on the evaluation set:
* Loss: 0.1057
Model description
-----------------
More information needed
Intended uses & limitations
---------------------------
More information needed
Training and evaluation data
----------------------------
More information needed
Training procedure
------------------
### Training hyperparameters
The following hyperparameters were used during training:
* learning\_rate: 0.0003
* train\_batch\_size: 8
* eval\_batch\_size: 8
* seed: 42
* gradient\_accumulation\_steps: 16
* total\_train\_batch\_size: 128
* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
* lr\_scheduler\_type: cosine\_with\_restarts
* lr\_scheduler\_warmup\_steps: 100
* num\_epochs: 3
* mixed\_precision\_training: Native AMP
### Training results
### Framework versions
* Transformers 4.36.0.dev0
* Pytorch 2.1.2+cu121
* Datasets 2.14.6
* Tokenizers 0.14.1
| [
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 100\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] | [
"TAGS\n#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us \n",
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 100\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] |
null | peft |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# adapter
This model is a fine-tuned version of [Helsinki-NLP/opus-mt-ROMANCE-en](https://huggingface.co/Helsinki-NLP/opus-mt-ROMANCE-en) on the generator dataset.
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 0.0002
- train_batch_size: 4
- eval_batch_size: 8
- seed: 42
- gradient_accumulation_steps: 2
- total_train_batch_size: 8
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: cosine
- lr_scheduler_warmup_ratio: 0.03
- num_epochs: 15
### Training results
### Framework versions
- PEFT 0.10.1.dev0
- Transformers 4.40.0
- Pytorch 2.1.0+cu121
- Datasets 2.19.0
- Tokenizers 0.19.1 | {"license": "apache-2.0", "library_name": "peft", "tags": ["trl", "sft", "generated_from_trainer"], "datasets": ["generator"], "base_model": "Helsinki-NLP/opus-mt-ROMANCE-en", "model-index": [{"name": "adapter", "results": []}]} | shaurya-06/adapter | null | [
"peft",
"tensorboard",
"safetensors",
"trl",
"sft",
"generated_from_trainer",
"dataset:generator",
"base_model:Helsinki-NLP/opus-mt-ROMANCE-en",
"license:apache-2.0",
"region:us"
] | null | 2024-04-28T21:23:47+00:00 | [] | [] | TAGS
#peft #tensorboard #safetensors #trl #sft #generated_from_trainer #dataset-generator #base_model-Helsinki-NLP/opus-mt-ROMANCE-en #license-apache-2.0 #region-us
|
# adapter
This model is a fine-tuned version of Helsinki-NLP/opus-mt-ROMANCE-en on the generator dataset.
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 0.0002
- train_batch_size: 4
- eval_batch_size: 8
- seed: 42
- gradient_accumulation_steps: 2
- total_train_batch_size: 8
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: cosine
- lr_scheduler_warmup_ratio: 0.03
- num_epochs: 15
### Training results
### Framework versions
- PEFT 0.10.1.dev0
- Transformers 4.40.0
- Pytorch 2.1.0+cu121
- Datasets 2.19.0
- Tokenizers 0.19.1 | [
"# adapter\n\nThis model is a fine-tuned version of Helsinki-NLP/opus-mt-ROMANCE-en on the generator dataset.",
"## Model description\n\nMore information needed",
"## Intended uses & limitations\n\nMore information needed",
"## Training and evaluation data\n\nMore information needed",
"## Training procedure",
"### Training hyperparameters\n\nThe following hyperparameters were used during training:\n- learning_rate: 0.0002\n- train_batch_size: 4\n- eval_batch_size: 8\n- seed: 42\n- gradient_accumulation_steps: 2\n- total_train_batch_size: 8\n- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n- lr_scheduler_type: cosine\n- lr_scheduler_warmup_ratio: 0.03\n- num_epochs: 15",
"### Training results",
"### Framework versions\n\n- PEFT 0.10.1.dev0\n- Transformers 4.40.0\n- Pytorch 2.1.0+cu121\n- Datasets 2.19.0\n- Tokenizers 0.19.1"
] | [
"TAGS\n#peft #tensorboard #safetensors #trl #sft #generated_from_trainer #dataset-generator #base_model-Helsinki-NLP/opus-mt-ROMANCE-en #license-apache-2.0 #region-us \n",
"# adapter\n\nThis model is a fine-tuned version of Helsinki-NLP/opus-mt-ROMANCE-en on the generator dataset.",
"## Model description\n\nMore information needed",
"## Intended uses & limitations\n\nMore information needed",
"## Training and evaluation data\n\nMore information needed",
"## Training procedure",
"### Training hyperparameters\n\nThe following hyperparameters were used during training:\n- learning_rate: 0.0002\n- train_batch_size: 4\n- eval_batch_size: 8\n- seed: 42\n- gradient_accumulation_steps: 2\n- total_train_batch_size: 8\n- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n- lr_scheduler_type: cosine\n- lr_scheduler_warmup_ratio: 0.03\n- num_epochs: 15",
"### Training results",
"### Framework versions\n\n- PEFT 0.10.1.dev0\n- Transformers 4.40.0\n- Pytorch 2.1.0+cu121\n- Datasets 2.19.0\n- Tokenizers 0.19.1"
] |
text2text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "datasets": ["timdettmers/openassistant-guanaco"], "pipeline_tag": "text2text-generation"} | acayir64/phi-3-colab-sft-merged-model | null | [
"transformers",
"safetensors",
"phi3",
"text-generation",
"text2text-generation",
"custom_code",
"dataset:timdettmers/openassistant-guanaco",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:24:32+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #phi3 #text-generation #text2text-generation #custom_code #dataset-timdettmers/openassistant-guanaco #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #phi3 #text-generation #text2text-generation #custom_code #dataset-timdettmers/openassistant-guanaco #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | shallow6414/90iria4 | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T21:26:42+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-to-image | diffusers |
<!-- This model card has been generated automatically according to the information the training script had access to. You
should probably proofread and complete it, then remove this comment. -->
# DreamBooth - yuffish/dog-segmented
This is a dreambooth model derived from stabilityai/stable-diffusion-2-1-base. The weights were trained on a photo of sks object using [DreamBooth](https://dreambooth.github.io/).
You can find some example images in the following.
DreamBooth for the text encoder was enabled: False.
## Intended uses & limitations
#### How to use
```python
# TODO: add an example code snippet for running this diffusion pipeline
```
#### Limitations and bias
[TODO: provide examples of latent issues and potential remediations]
## Training details
[TODO: describe the data used to train the model] | {"license": "creativeml-openrail-m", "library_name": "diffusers", "tags": ["text-to-image", "dreambooth", "diffusers-training", "stable-diffusion", "stable-diffusion-diffusers"], "inference": true, "base_model": "stabilityai/stable-diffusion-2-1-base", "instance_prompt": "a photo of sks object"} | yuffish/dog-segmented | null | [
"diffusers",
"tensorboard",
"safetensors",
"text-to-image",
"dreambooth",
"diffusers-training",
"stable-diffusion",
"stable-diffusion-diffusers",
"base_model:stabilityai/stable-diffusion-2-1-base",
"license:creativeml-openrail-m",
"endpoints_compatible",
"diffusers:StableDiffusionPipeline",
"region:us"
] | null | 2024-04-28T21:29:00+00:00 | [] | [] | TAGS
#diffusers #tensorboard #safetensors #text-to-image #dreambooth #diffusers-training #stable-diffusion #stable-diffusion-diffusers #base_model-stabilityai/stable-diffusion-2-1-base #license-creativeml-openrail-m #endpoints_compatible #diffusers-StableDiffusionPipeline #region-us
|
# DreamBooth - yuffish/dog-segmented
This is a dreambooth model derived from stabilityai/stable-diffusion-2-1-base. The weights were trained on a photo of sks object using DreamBooth.
You can find some example images in the following.
DreamBooth for the text encoder was enabled: False.
## Intended uses & limitations
#### How to use
#### Limitations and bias
[TODO: provide examples of latent issues and potential remediations]
## Training details
[TODO: describe the data used to train the model] | [
"# DreamBooth - yuffish/dog-segmented\n\nThis is a dreambooth model derived from stabilityai/stable-diffusion-2-1-base. The weights were trained on a photo of sks object using DreamBooth.\nYou can find some example images in the following. \n\n\n\nDreamBooth for the text encoder was enabled: False.",
"## Intended uses & limitations",
"#### How to use",
"#### Limitations and bias\n\n[TODO: provide examples of latent issues and potential remediations]",
"## Training details\n\n[TODO: describe the data used to train the model]"
] | [
"TAGS\n#diffusers #tensorboard #safetensors #text-to-image #dreambooth #diffusers-training #stable-diffusion #stable-diffusion-diffusers #base_model-stabilityai/stable-diffusion-2-1-base #license-creativeml-openrail-m #endpoints_compatible #diffusers-StableDiffusionPipeline #region-us \n",
"# DreamBooth - yuffish/dog-segmented\n\nThis is a dreambooth model derived from stabilityai/stable-diffusion-2-1-base. The weights were trained on a photo of sks object using DreamBooth.\nYou can find some example images in the following. \n\n\n\nDreamBooth for the text encoder was enabled: False.",
"## Intended uses & limitations",
"#### How to use",
"#### Limitations and bias\n\n[TODO: provide examples of latent issues and potential remediations]",
"## Training details\n\n[TODO: describe the data used to train the model]"
] |
null | null |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# G0428HMA15
This model is a fine-tuned version of [google/gemma-2b](https://huggingface.co/google/gemma-2b) on an unknown dataset.
It achieves the following results on the evaluation set:
- Loss: 0.1057
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 0.0003
- train_batch_size: 8
- eval_batch_size: 8
- seed: 42
- gradient_accumulation_steps: 16
- total_train_batch_size: 128
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: cosine_with_restarts
- lr_scheduler_warmup_steps: 100
- num_epochs: 3
- mixed_precision_training: Native AMP
### Training results
| Training Loss | Epoch | Step | Validation Loss |
|:-------------:|:-----:|:----:|:---------------:|
| 2.6372 | 0.09 | 10 | 1.7096 |
| 1.1238 | 0.18 | 20 | 0.4795 |
| 0.2595 | 0.27 | 30 | 0.1668 |
| 0.155 | 0.36 | 40 | 0.1603 |
| 0.1489 | 0.45 | 50 | 0.1483 |
| 0.1474 | 0.54 | 60 | 0.1499 |
| 0.1479 | 0.63 | 70 | 0.1470 |
| 0.1491 | 0.73 | 80 | 0.1479 |
| 0.1413 | 0.82 | 90 | 0.1486 |
| 0.1448 | 0.91 | 100 | 0.1479 |
| 0.1492 | 1.0 | 110 | 0.1488 |
| 0.1429 | 1.09 | 120 | 0.1485 |
| 0.1447 | 1.18 | 130 | 0.1485 |
| 0.146 | 1.27 | 140 | 0.1473 |
| 0.1478 | 1.36 | 150 | 0.1466 |
| 0.1423 | 1.45 | 160 | 0.1507 |
| 0.1434 | 1.54 | 170 | 0.1435 |
| 0.1392 | 1.63 | 180 | 0.1377 |
| 0.1379 | 1.72 | 190 | 0.1359 |
| 0.1285 | 1.81 | 200 | 0.1294 |
| 0.1271 | 1.9 | 210 | 0.1303 |
| 0.1269 | 1.99 | 220 | 0.1228 |
| 0.1118 | 2.08 | 230 | 0.1210 |
| 0.1144 | 2.18 | 240 | 0.1153 |
| 0.1106 | 2.27 | 250 | 0.1123 |
| 0.1116 | 2.36 | 260 | 0.1155 |
| 0.1158 | 2.45 | 270 | 0.1118 |
| 0.1066 | 2.54 | 280 | 0.1109 |
| 0.0991 | 2.63 | 290 | 0.1098 |
| 0.1016 | 2.72 | 300 | 0.1064 |
| 0.1029 | 2.81 | 310 | 0.1058 |
| 0.1052 | 2.9 | 320 | 0.1057 |
| 0.106 | 2.99 | 330 | 0.1057 |
### Framework versions
- Transformers 4.36.0.dev0
- Pytorch 2.1.2+cu121
- Datasets 2.14.6
- Tokenizers 0.14.1
| {"license": "gemma", "tags": ["generated_from_trainer"], "base_model": "google/gemma-2b", "model-index": [{"name": "G0428HMA15", "results": []}]} | Litzy619/G0428HMA15 | null | [
"safetensors",
"generated_from_trainer",
"base_model:google/gemma-2b",
"license:gemma",
"region:us"
] | null | 2024-04-28T21:30:27+00:00 | [] | [] | TAGS
#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us
| G0428HMA15
==========
This model is a fine-tuned version of google/gemma-2b on an unknown dataset.
It achieves the following results on the evaluation set:
* Loss: 0.1057
Model description
-----------------
More information needed
Intended uses & limitations
---------------------------
More information needed
Training and evaluation data
----------------------------
More information needed
Training procedure
------------------
### Training hyperparameters
The following hyperparameters were used during training:
* learning\_rate: 0.0003
* train\_batch\_size: 8
* eval\_batch\_size: 8
* seed: 42
* gradient\_accumulation\_steps: 16
* total\_train\_batch\_size: 128
* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
* lr\_scheduler\_type: cosine\_with\_restarts
* lr\_scheduler\_warmup\_steps: 100
* num\_epochs: 3
* mixed\_precision\_training: Native AMP
### Training results
### Framework versions
* Transformers 4.36.0.dev0
* Pytorch 2.1.2+cu121
* Datasets 2.14.6
* Tokenizers 0.14.1
| [
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 100\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] | [
"TAGS\n#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us \n",
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 100\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] |
text-classification | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | HC-85/distilbert-arxiv-multilabel-b16 | null | [
"transformers",
"safetensors",
"distilbert",
"text-classification",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:30:29+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #distilbert #text-classification #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #distilbert #text-classification #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-classification | transformers |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# distilbert-base-uncased-finetuned-cola
This model is a fine-tuned version of [distilbert-base-uncased](https://huggingface.co/distilbert-base-uncased) on an unknown dataset.
It achieves the following results on the evaluation set:
- Loss: 0.9675
- Matthews Correlation: 0.5347
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 2e-05
- train_batch_size: 16
- eval_batch_size: 16
- seed: 42
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: linear
- num_epochs: 5
### Training results
| Training Loss | Epoch | Step | Validation Loss | Matthews Correlation |
|:-------------:|:-----:|:----:|:---------------:|:--------------------:|
| 0.3536 | 1.0 | 535 | 0.4962 | 0.4748 |
| 0.2332 | 2.0 | 1070 | 0.6062 | 0.5024 |
| 0.1681 | 3.0 | 1605 | 0.7948 | 0.5262 |
| 0.137 | 4.0 | 2140 | 0.9381 | 0.5023 |
| 0.0804 | 5.0 | 2675 | 0.9675 | 0.5347 |
### Framework versions
- Transformers 4.41.0.dev0
- Pytorch 2.2.1+cu121
- Datasets 2.19.0
- Tokenizers 0.19.1
| {"license": "apache-2.0", "tags": ["generated_from_trainer"], "metrics": ["matthews_correlation"], "base_model": "distilbert-base-uncased", "model-index": [{"name": "distilbert-base-uncased-finetuned-cola", "results": []}]} | GIdM/distilbert-base-uncased-finetuned-cola | null | [
"transformers",
"tensorboard",
"safetensors",
"distilbert",
"text-classification",
"generated_from_trainer",
"base_model:distilbert-base-uncased",
"license:apache-2.0",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:32:16+00:00 | [] | [] | TAGS
#transformers #tensorboard #safetensors #distilbert #text-classification #generated_from_trainer #base_model-distilbert-base-uncased #license-apache-2.0 #autotrain_compatible #endpoints_compatible #region-us
| distilbert-base-uncased-finetuned-cola
======================================
This model is a fine-tuned version of distilbert-base-uncased on an unknown dataset.
It achieves the following results on the evaluation set:
* Loss: 0.9675
* Matthews Correlation: 0.5347
Model description
-----------------
More information needed
Intended uses & limitations
---------------------------
More information needed
Training and evaluation data
----------------------------
More information needed
Training procedure
------------------
### Training hyperparameters
The following hyperparameters were used during training:
* learning\_rate: 2e-05
* train\_batch\_size: 16
* eval\_batch\_size: 16
* seed: 42
* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
* lr\_scheduler\_type: linear
* num\_epochs: 5
### Training results
### Framework versions
* Transformers 4.41.0.dev0
* Pytorch 2.2.1+cu121
* Datasets 2.19.0
* Tokenizers 0.19.1
| [
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 2e-05\n* train\\_batch\\_size: 16\n* eval\\_batch\\_size: 16\n* seed: 42\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: linear\n* num\\_epochs: 5",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.41.0.dev0\n* Pytorch 2.2.1+cu121\n* Datasets 2.19.0\n* Tokenizers 0.19.1"
] | [
"TAGS\n#transformers #tensorboard #safetensors #distilbert #text-classification #generated_from_trainer #base_model-distilbert-base-uncased #license-apache-2.0 #autotrain_compatible #endpoints_compatible #region-us \n",
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 2e-05\n* train\\_batch\\_size: 16\n* eval\\_batch\\_size: 16\n* seed: 42\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: linear\n* num\\_epochs: 5",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.41.0.dev0\n* Pytorch 2.2.1+cu121\n* Datasets 2.19.0\n* Tokenizers 0.19.1"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | GamblerOnTrain/CAWD041 | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T21:32:30+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | GamblerOnTrain/CAWD645 | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T21:32:34+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers |
## Model Details
We introduce Llama3-ChatQA-1.5, which excels at conversational question answering (QA) and retrieval-augmented generation (RAG). Llama3-ChatQA-1.5 is developed using an improved training recipe from [ChatQA (1.0)](https://arxiv.org/abs/2401.10225), and it is built on top of [Llama-3 base model](https://huggingface.co/meta-llama/Meta-Llama-3-8B). Specifically, we incorporate more conversational QA data to enhance its tabular and arithmetic calculation capability. Llama3-ChatQA-1.5 has two variants: Llama3-ChatQA-1.5-8B and Llama3-ChatQA-1.5-70B. Both models were originally trained using [Megatron-LM](https://github.com/NVIDIA/Megatron-LM), we converted the checkpoints to Hugging Face format.
## Other Resources
[Llama3-ChatQA-1.5-70B](https://huggingface.co/nvidia/Llama3-ChatQA-1.5-70B)   [Evaluation Data](https://huggingface.co/datasets/nvidia/ConvRAG-Bench)   [Training Data](https://huggingface.co/datasets/nvidia/ChatQA-Training-Data)   [Retriever](https://huggingface.co/nvidia/dragon-multiturn-query-encoder)
## Benchmark Results
Results in ConvRAG Bench are as follows:
| | ChatQA-1.0-7B | Command-R-Plus | Llama-3-instruct-70b | GPT-4-0613 | ChatQA-1.0-70B | ChatQA-1.5-8B | ChatQA-1.5-70B |
| -- |:--:|:--:|:--:|:--:|:--:|:--:|:--:|
| Doc2Dial | 37.88 | 33.51 | 37.88 | 34.16 | 38.9 | 39.33 | 41.26 |
| QuAC | 29.69 | 34.16 | 36.96 | 40.29 | 41.82 | 39.73 | 38.82 |
| QReCC | 46.97 | 49.77 | 51.34 | 52.01 | 48.05 | 49.03 | 51.40 |
| CoQA | 76.61 | 69.71 | 76.98 | 77.42 | 78.57 | 76.46 | 78.44 |
| DoQA | 41.57 | 40.67 | 41.24 | 43.39 | 51.94 | 49.6 | 50.67 |
| ConvFinQA | 51.61 | 71.21 | 76.6 | 81.28 | 73.69 | 78.46 | 81.88 |
| SQA | 61.87 | 74.07 | 69.61 | 79.21 | 69.14 | 73.28 | 83.82 |
| TopioCQA | 45.45 | 53.77 | 49.72 | 45.09 | 50.98 | 49.96 | 55.63 |
| HybriDial* | 54.51 | 46.7 | 48.59 | 49.81 | 56.44 | 65.76 | 68.27 |
| INSCIT | 30.96 | 35.76 | 36.23 | 36.34 | 31.9 | 30.1 | 32.31 |
| Average (all) | 47.71 | 50.93 | 52.52 | 53.90 | 54.14 | 55.17 | 58.25 |
| Average (exclude HybriDial) | 46.96 | 51.40 | 52.95 | 54.35 | 53.89 | 53.99 | 57.14 |
Note that ChatQA-1.5 is built based on Llama-3 base model, and ChatQA-1.0 is built based on Llama-2 base model. ChatQA-1.5 used some samples from the HybriDial training dataset. To ensure fair comparison, we also compare average scores excluding HybriDial. The data and evaluation scripts for ConvRAG can be found [here](https://huggingface.co/datasets/nvidia/ConvRAG-Bench).
## Prompt Format
<pre>
System: {System}
{Context}
User: {Question}
Assistant: {Response}
User: {Question}
Assistant:
</pre>
## How to use
### take the whole document as context
This can be applied to the scenario where the whole document can be fitted into the model, so that there is no need to run retrieval over the document.
```python
from transformers import AutoTokenizer, AutoModelForCausalLM
import torch
model_id = "nvidia/Llama3-ChatQA-1.5-8B"
tokenizer = AutoTokenizer.from_pretrained(model_id)
model = AutoModelForCausalLM.from_pretrained(model_id, torch_dtype=torch.float16, device_map="auto")
messages = [
{"role": "user", "content": "what is the percentage change of the net income from Q4 FY23 to Q4 FY24?"}
]
document = """NVIDIA (NASDAQ: NVDA) today reported revenue for the fourth quarter ended January 28, 2024, of $22.1 billion, up 22% from the previous quarter and up 265% from a year ago.\nFor the quarter, GAAP earnings per diluted share was $4.93, up 33% from the previous quarter and up 765% from a year ago. Non-GAAP earnings per diluted share was $5.16, up 28% from the previous quarter and up 486% from a year ago.\nQ4 Fiscal 2024 Summary\nGAAP\n| $ in millions, except earnings per share | Q4 FY24 | Q3 FY24 | Q4 FY23 | Q/Q | Y/Y |\n| Revenue | $22,103 | $18,120 | $6,051 | Up 22% | Up 265% |\n| Gross margin | 76.0% | 74.0% | 63.3% | Up 2.0 pts | Up 12.7 pts |\n| Operating expenses | $3,176 | $2,983 | $2,576 | Up 6% | Up 23% |\n| Operating income | $13,615 | $10,417 | $1,257 | Up 31% | Up 983% |\n| Net income | $12,285 | $9,243 | $1,414 | Up 33% | Up 769% |\n| Diluted earnings per share | $4.93 | $3.71 | $0.57 | Up 33% | Up 765% |"""
def get_formatted_input(messages, context):
system = "System: This is a chat between a user and an artificial intelligence assistant. The assistant gives helpful, detailed, and polite answers to the user's questions based on the context. The assistant should also indicate when the answer cannot be found in the context."
instruction = "Please give a full and complete answer for the question."
for item in messages:
if item['role'] == "user":
## only apply this instruction for the first user turn
item['content'] = instruction + " " + item['content']
break
conversation = '\n\n'.join(["User: " + item["content"] if item["role"] == "user" else "Assistant: " + item["content"] for item in messages]) + "\n\nAssistant:"
formatted_input = system + "\n\n" + context + "\n\n" + conversation
return formatted_input
formatted_input = get_formatted_input(messages, document)
tokenized_prompt = tokenizer(tokenizer.bos_token + formatted_input, return_tensors="pt").to(model.device)
terminators = [
tokenizer.eos_token_id,
tokenizer.convert_tokens_to_ids("<|eot_id|>")
]
outputs = model.generate(input_ids=tokenized_prompt.input_ids, attention_mask=tokenized_prompt.attention_mask, max_new_tokens=128, eos_token_id=terminators)
response = outputs[0][tokenized_prompt.input_ids.shape[-1]:]
print(tokenizer.decode(response, skip_special_tokens=True))
```
### run retrieval to get top-n chunks as context
This can be applied to the scenario when the document is very long, so that it is necessary to run retrieval. Here, we use our [Dragon-multiturn](https://huggingface.co/nvidia/dragon-multiturn-query-encoder) retriever which can handle conversatinoal query. In addition, we provide a few [documents](https://huggingface.co/nvidia/Llama3-ChatQA-1.5-8B/tree/main/docs) for users to play with.
```python
from transformers import AutoTokenizer, AutoModelForCausalLM, AutoModel
import torch
import json
## load ChatQA-1.5 tokenizer and model
model_id = "nvidia/Llama3-ChatQA-1.5-8B"
tokenizer = AutoTokenizer.from_pretrained(model_id)
model = AutoModelForCausalLM.from_pretrained(model_id, torch_dtype=torch.float16, device_map="auto")
## load retriever tokenizer and model
retriever_tokenizer = AutoTokenizer.from_pretrained('nvidia/dragon-multiturn-query-encoder')
query_encoder = AutoModel.from_pretrained('nvidia/dragon-multiturn-query-encoder')
context_encoder = AutoModel.from_pretrained('nvidia/dragon-multiturn-context-encoder')
## prepare documents, we take landrover car manual document that we provide as an example
chunk_list = json.load(open("docs.json"))['landrover']
messages = [
{"role": "user", "content": "how to connect the bluetooth in the car?"}
]
### running retrieval
## convert query into a format as follows:
## user: {user}\nagent: {agent}\nuser: {user}
formatted_query_for_retriever = '\n'.join([turn['role'] + ": " + turn['content'] for turn in messages]).strip()
query_input = retriever_tokenizer(formatted_query_for_retriever, return_tensors='pt')
ctx_input = retriever_tokenizer(chunk_list, padding=True, truncation=True, max_length=512, return_tensors='pt')
query_emb = query_encoder(**query_input).last_hidden_state[:, 0, :]
ctx_emb = context_encoder(**ctx_input).last_hidden_state[:, 0, :]
## Compute similarity scores using dot product and rank the similarity
similarities = query_emb.matmul(ctx_emb.transpose(0, 1)) # (1, num_ctx)
ranked_results = torch.argsort(similarities, dim=-1, descending=True) # (1, num_ctx)
## get top-n chunks (n=5)
retrieved_chunks = [chunk_list[idx] for idx in ranked_results.tolist()[0][:5]]
context = "\n\n".join(retrieved_chunks)
### running text generation
formatted_input = get_formatted_input(messages, context)
tokenized_prompt = tokenizer(tokenizer.bos_token + formatted_input, return_tensors="pt").to(model.device)
terminators = [
tokenizer.eos_token_id,
tokenizer.convert_tokens_to_ids("<|eot_id|>")
]
outputs = model.generate(input_ids=tokenized_prompt.input_ids, attention_mask=tokenized_prompt.attention_mask, max_new_tokens=128, eos_token_id=terminators)
response = outputs[0][tokenized_prompt.input_ids.shape[-1]:]
print(tokenizer.decode(response, skip_special_tokens=True))
```
## Correspondence to
Zihan Liu ([email protected]), Wei Ping ([email protected])
## Citation
<pre>
@article{liu2024chatqa,
title={ChatQA: Building GPT-4 Level Conversational QA Models},
author={Liu, Zihan and Ping, Wei and Roy, Rajarshi and Xu, Peng and Lee, Chankyu and Shoeybi, Mohammad and Catanzaro, Bryan},
journal={arXiv preprint arXiv:2401.10225},
year={2024}}
</pre>
## License
The use of this model is governed by the [META LLAMA 3 COMMUNITY LICENSE AGREEMENT](https://llama.meta.com/llama3/license/)
| {"language": ["en"], "license": "llama3", "tags": ["nvidia", "chatqa-1.5", "chatqa", "llama-3", "pytorch"], "pipeline_tag": "text-generation"} | nvidia/Llama3-ChatQA-1.5-8B | null | [
"transformers",
"pytorch",
"llama",
"text-generation",
"nvidia",
"chatqa-1.5",
"chatqa",
"llama-3",
"en",
"arxiv:2401.10225",
"license:llama3",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us",
"has_space"
] | null | 2024-04-28T21:32:50+00:00 | [
"2401.10225"
] | [
"en"
] | TAGS
#transformers #pytorch #llama #text-generation #nvidia #chatqa-1.5 #chatqa #llama-3 #en #arxiv-2401.10225 #license-llama3 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us #has_space
| Model Details
-------------
We introduce Llama3-ChatQA-1.5, which excels at conversational question answering (QA) and retrieval-augmented generation (RAG). Llama3-ChatQA-1.5 is developed using an improved training recipe from ChatQA (1.0), and it is built on top of Llama-3 base model. Specifically, we incorporate more conversational QA data to enhance its tabular and arithmetic calculation capability. Llama3-ChatQA-1.5 has two variants: Llama3-ChatQA-1.5-8B and Llama3-ChatQA-1.5-70B. Both models were originally trained using Megatron-LM, we converted the checkpoints to Hugging Face format.
Other Resources
---------------
Llama3-ChatQA-1.5-70B Evaluation Data Training Data Retriever
Benchmark Results
-----------------
Results in ConvRAG Bench are as follows:
Note that ChatQA-1.5 is built based on Llama-3 base model, and ChatQA-1.0 is built based on Llama-2 base model. ChatQA-1.5 used some samples from the HybriDial training dataset. To ensure fair comparison, we also compare average scores excluding HybriDial. The data and evaluation scripts for ConvRAG can be found here.
Prompt Format
-------------
```
System: {System}
{Context}
User: {Question}
Assistant: {Response}
User: {Question}
Assistant:
```
How to use
----------
### take the whole document as context
This can be applied to the scenario where the whole document can be fitted into the model, so that there is no need to run retrieval over the document.
### run retrieval to get top-n chunks as context
This can be applied to the scenario when the document is very long, so that it is necessary to run retrieval. Here, we use our Dragon-multiturn retriever which can handle conversatinoal query. In addition, we provide a few documents for users to play with.
Correspondence to
-----------------
Zihan Liu (zihanl@URL), Wei Ping (wping@URL)
```
@article{liu2024chatqa,
title={ChatQA: Building GPT-4 Level Conversational QA Models},
author={Liu, Zihan and Ping, Wei and Roy, Rajarshi and Xu, Peng and Lee, Chankyu and Shoeybi, Mohammad and Catanzaro, Bryan},
journal={arXiv preprint arXiv:2401.10225},
year={2024}}
```
License
-------
The use of this model is governed by the META LLAMA 3 COMMUNITY LICENSE AGREEMENT
| [
"### take the whole document as context\n\n\nThis can be applied to the scenario where the whole document can be fitted into the model, so that there is no need to run retrieval over the document.",
"### run retrieval to get top-n chunks as context\n\n\nThis can be applied to the scenario when the document is very long, so that it is necessary to run retrieval. Here, we use our Dragon-multiturn retriever which can handle conversatinoal query. In addition, we provide a few documents for users to play with.\n\n\nCorrespondence to\n-----------------\n\n\nZihan Liu (zihanl@URL), Wei Ping (wping@URL)\n\n\n\n```\n\n@article{liu2024chatqa,\n title={ChatQA: Building GPT-4 Level Conversational QA Models},\n author={Liu, Zihan and Ping, Wei and Roy, Rajarshi and Xu, Peng and Lee, Chankyu and Shoeybi, Mohammad and Catanzaro, Bryan},\n journal={arXiv preprint arXiv:2401.10225},\n year={2024}}\n\n```\n\nLicense\n-------\n\n\nThe use of this model is governed by the META LLAMA 3 COMMUNITY LICENSE AGREEMENT"
] | [
"TAGS\n#transformers #pytorch #llama #text-generation #nvidia #chatqa-1.5 #chatqa #llama-3 #en #arxiv-2401.10225 #license-llama3 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us #has_space \n",
"### take the whole document as context\n\n\nThis can be applied to the scenario where the whole document can be fitted into the model, so that there is no need to run retrieval over the document.",
"### run retrieval to get top-n chunks as context\n\n\nThis can be applied to the scenario when the document is very long, so that it is necessary to run retrieval. Here, we use our Dragon-multiturn retriever which can handle conversatinoal query. In addition, we provide a few documents for users to play with.\n\n\nCorrespondence to\n-----------------\n\n\nZihan Liu (zihanl@URL), Wei Ping (wping@URL)\n\n\n\n```\n\n@article{liu2024chatqa,\n title={ChatQA: Building GPT-4 Level Conversational QA Models},\n author={Liu, Zihan and Ping, Wei and Roy, Rajarshi and Xu, Peng and Lee, Chankyu and Shoeybi, Mohammad and Catanzaro, Bryan},\n journal={arXiv preprint arXiv:2401.10225},\n year={2024}}\n\n```\n\nLicense\n-------\n\n\nThe use of this model is governed by the META LLAMA 3 COMMUNITY LICENSE AGREEMENT"
] |
null | transformers |
# Uploaded model
- **Developed by:** zz-xx
- **License:** apache-2.0
- **Finetuned from model :** unsloth/gemma-7b-bnb-4bit
This gemma model was trained 2x faster with [Unsloth](https://github.com/unslothai/unsloth) and Huggingface's TRL library.
[<img src="https://raw.githubusercontent.com/unslothai/unsloth/main/images/unsloth%20made%20with%20love.png" width="200"/>](https://github.com/unslothai/unsloth)
| {"language": ["en"], "license": "apache-2.0", "tags": ["text-generation-inference", "transformers", "unsloth", "gemma", "gguf"], "base_model": "unsloth/gemma-7b-bnb-4bit"} | zz-xx/gemma-7b-bnb-4bit-bias-f16 | null | [
"transformers",
"gguf",
"gemma",
"text-generation-inference",
"unsloth",
"en",
"base_model:unsloth/gemma-7b-bnb-4bit",
"license:apache-2.0",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:32:54+00:00 | [] | [
"en"
] | TAGS
#transformers #gguf #gemma #text-generation-inference #unsloth #en #base_model-unsloth/gemma-7b-bnb-4bit #license-apache-2.0 #endpoints_compatible #region-us
|
# Uploaded model
- Developed by: zz-xx
- License: apache-2.0
- Finetuned from model : unsloth/gemma-7b-bnb-4bit
This gemma model was trained 2x faster with Unsloth and Huggingface's TRL library.
<img src="URL width="200"/>
| [
"# Uploaded model\n\n- Developed by: zz-xx\n- License: apache-2.0\n- Finetuned from model : unsloth/gemma-7b-bnb-4bit\n\nThis gemma model was trained 2x faster with Unsloth and Huggingface's TRL library.\n\n<img src=\"URL width=\"200\"/>"
] | [
"TAGS\n#transformers #gguf #gemma #text-generation-inference #unsloth #en #base_model-unsloth/gemma-7b-bnb-4bit #license-apache-2.0 #endpoints_compatible #region-us \n",
"# Uploaded model\n\n- Developed by: zz-xx\n- License: apache-2.0\n- Finetuned from model : unsloth/gemma-7b-bnb-4bit\n\nThis gemma model was trained 2x faster with Unsloth and Huggingface's TRL library.\n\n<img src=\"URL width=\"200\"/>"
] |
text-generation | transformers |
## StableGPT4-Micro-1.6B
StableGPT4-Micro-1.6B is a conversational AI model trained on the ChatGPT chats, designed to generate text-based responses for various conversational scenarios. This model has been fine-tuned and optimized for stability and reliability, providing coherent and contextually appropriate responses across a wide range of topics.
### Usage
You can interact with the StableGPT4-Micro-1.6B model by providing it with prompts in JSON format. Each prompt should include the role of the speaker ("user" or "assistant") and the text of their message.
### Example
```json
{"role": "user", "text": "Hi"}
{"role": "assistant", "text": "Hello! How can I help you today? If you have any questions or need assistance, feel free to ask."}
{"role": "user", "text": "write hello world in c++"}
{"role": "assistant", "text": "Here's a simple `HelloWorld` program in C++:\n```cpp\n#include <iostream>\n\nint main() {\n std::cout << \"Hello, World!\" << std::endl;\n return 0;\n}\n```\nThis code uses the `<iostream>` standard library to create a `std::cout` stream and print the string \"Hello, World!\" to the standard output. The `return 0` statement indicates that the program has finished running and returns the control to the user. You can run this program on your C++ compiler's command line or integrated development environment (IDE) to see the output."}
```
### Test
You can use gen.py to test the model.
### Notes
- The model is trained to provide helpful and informative responses based on the input prompts.
- While the model strives to maintain coherence and relevance, it may occasionally generate unexpected or nonsensical outputs.
Please feel free to experiment with the model and provide feedback on its performance and usability. | {"library_name": "transformers", "datasets": ["openchat/openchat_sharegpt4_dataset", "ifmain/gpt4myself"], "base_model": "stabilityai/stablelm-2-zephyr-1_6b", "pipeline_tag": "text-generation"} | ifmain/StableGPT4-Micro-1.6B | null | [
"transformers",
"safetensors",
"stablelm",
"text-generation",
"conversational",
"dataset:openchat/openchat_sharegpt4_dataset",
"dataset:ifmain/gpt4myself",
"base_model:stabilityai/stablelm-2-zephyr-1_6b",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:38:54+00:00 | [] | [] | TAGS
#transformers #safetensors #stablelm #text-generation #conversational #dataset-openchat/openchat_sharegpt4_dataset #dataset-ifmain/gpt4myself #base_model-stabilityai/stablelm-2-zephyr-1_6b #autotrain_compatible #endpoints_compatible #region-us
|
## StableGPT4-Micro-1.6B
StableGPT4-Micro-1.6B is a conversational AI model trained on the ChatGPT chats, designed to generate text-based responses for various conversational scenarios. This model has been fine-tuned and optimized for stability and reliability, providing coherent and contextually appropriate responses across a wide range of topics.
### Usage
You can interact with the StableGPT4-Micro-1.6B model by providing it with prompts in JSON format. Each prompt should include the role of the speaker ("user" or "assistant") and the text of their message.
### Example
cpp\n#include <iostream>\n\nint main() {\n std::cout << \"Hello, World!\" << std::endl;\n return 0;\n}\n
### Test
You can use URL to test the model.
### Notes
- The model is trained to provide helpful and informative responses based on the input prompts.
- While the model strives to maintain coherence and relevance, it may occasionally generate unexpected or nonsensical outputs.
Please feel free to experiment with the model and provide feedback on its performance and usability. | [
"## StableGPT4-Micro-1.6B\n\nStableGPT4-Micro-1.6B is a conversational AI model trained on the ChatGPT chats, designed to generate text-based responses for various conversational scenarios. This model has been fine-tuned and optimized for stability and reliability, providing coherent and contextually appropriate responses across a wide range of topics.",
"### Usage\n\nYou can interact with the StableGPT4-Micro-1.6B model by providing it with prompts in JSON format. Each prompt should include the role of the speaker (\"user\" or \"assistant\") and the text of their message.",
"### Example\n\ncpp\\n#include <iostream>\\n\\nint main() {\\n std::cout << \\\"Hello, World!\\\" << std::endl;\\n return 0;\\n}\\n",
"### Test\n\nYou can use URL to test the model.",
"### Notes\n\n- The model is trained to provide helpful and informative responses based on the input prompts.\n- While the model strives to maintain coherence and relevance, it may occasionally generate unexpected or nonsensical outputs.\n\nPlease feel free to experiment with the model and provide feedback on its performance and usability."
] | [
"TAGS\n#transformers #safetensors #stablelm #text-generation #conversational #dataset-openchat/openchat_sharegpt4_dataset #dataset-ifmain/gpt4myself #base_model-stabilityai/stablelm-2-zephyr-1_6b #autotrain_compatible #endpoints_compatible #region-us \n",
"## StableGPT4-Micro-1.6B\n\nStableGPT4-Micro-1.6B is a conversational AI model trained on the ChatGPT chats, designed to generate text-based responses for various conversational scenarios. This model has been fine-tuned and optimized for stability and reliability, providing coherent and contextually appropriate responses across a wide range of topics.",
"### Usage\n\nYou can interact with the StableGPT4-Micro-1.6B model by providing it with prompts in JSON format. Each prompt should include the role of the speaker (\"user\" or \"assistant\") and the text of their message.",
"### Example\n\ncpp\\n#include <iostream>\\n\\nint main() {\\n std::cout << \\\"Hello, World!\\\" << std::endl;\\n return 0;\\n}\\n",
"### Test\n\nYou can use URL to test the model.",
"### Notes\n\n- The model is trained to provide helpful and informative responses based on the input prompts.\n- While the model strives to maintain coherence and relevance, it may occasionally generate unexpected or nonsensical outputs.\n\nPlease feel free to experiment with the model and provide feedback on its performance and usability."
] |
null | peft |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# monacan-translator-test
This model is a fine-tuned version of [mlabonne/NeuralMonarch-7B](https://huggingface.co/mlabonne/NeuralMonarch-7B) on the generator dataset.
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 0.0002
- train_batch_size: 3
- eval_batch_size: 8
- seed: 42
- gradient_accumulation_steps: 2
- total_train_batch_size: 6
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: constant
- lr_scheduler_warmup_ratio: 0.03
- num_epochs: 1
### Training results
### Framework versions
- PEFT 0.10.0
- Transformers 4.36.2
- Pytorch 2.1.2+cu121
- Datasets 2.16.1
- Tokenizers 0.15.2 | {"license": "cc-by-nc-4.0", "library_name": "peft", "tags": ["trl", "sft", "generated_from_trainer"], "datasets": ["generator"], "base_model": "mlabonne/NeuralMonarch-7B", "model-index": [{"name": "monacan-translator-test", "results": []}]} | yleo/monacan-translator-test | null | [
"peft",
"tensorboard",
"safetensors",
"trl",
"sft",
"generated_from_trainer",
"dataset:generator",
"base_model:mlabonne/NeuralMonarch-7B",
"license:cc-by-nc-4.0",
"region:us"
] | null | 2024-04-28T21:41:26+00:00 | [] | [] | TAGS
#peft #tensorboard #safetensors #trl #sft #generated_from_trainer #dataset-generator #base_model-mlabonne/NeuralMonarch-7B #license-cc-by-nc-4.0 #region-us
|
# monacan-translator-test
This model is a fine-tuned version of mlabonne/NeuralMonarch-7B on the generator dataset.
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 0.0002
- train_batch_size: 3
- eval_batch_size: 8
- seed: 42
- gradient_accumulation_steps: 2
- total_train_batch_size: 6
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: constant
- lr_scheduler_warmup_ratio: 0.03
- num_epochs: 1
### Training results
### Framework versions
- PEFT 0.10.0
- Transformers 4.36.2
- Pytorch 2.1.2+cu121
- Datasets 2.16.1
- Tokenizers 0.15.2 | [
"# monacan-translator-test\n\nThis model is a fine-tuned version of mlabonne/NeuralMonarch-7B on the generator dataset.",
"## Model description\n\nMore information needed",
"## Intended uses & limitations\n\nMore information needed",
"## Training and evaluation data\n\nMore information needed",
"## Training procedure",
"### Training hyperparameters\n\nThe following hyperparameters were used during training:\n- learning_rate: 0.0002\n- train_batch_size: 3\n- eval_batch_size: 8\n- seed: 42\n- gradient_accumulation_steps: 2\n- total_train_batch_size: 6\n- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n- lr_scheduler_type: constant\n- lr_scheduler_warmup_ratio: 0.03\n- num_epochs: 1",
"### Training results",
"### Framework versions\n\n- PEFT 0.10.0\n- Transformers 4.36.2\n- Pytorch 2.1.2+cu121\n- Datasets 2.16.1\n- Tokenizers 0.15.2"
] | [
"TAGS\n#peft #tensorboard #safetensors #trl #sft #generated_from_trainer #dataset-generator #base_model-mlabonne/NeuralMonarch-7B #license-cc-by-nc-4.0 #region-us \n",
"# monacan-translator-test\n\nThis model is a fine-tuned version of mlabonne/NeuralMonarch-7B on the generator dataset.",
"## Model description\n\nMore information needed",
"## Intended uses & limitations\n\nMore information needed",
"## Training and evaluation data\n\nMore information needed",
"## Training procedure",
"### Training hyperparameters\n\nThe following hyperparameters were used during training:\n- learning_rate: 0.0002\n- train_batch_size: 3\n- eval_batch_size: 8\n- seed: 42\n- gradient_accumulation_steps: 2\n- total_train_batch_size: 6\n- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n- lr_scheduler_type: constant\n- lr_scheduler_warmup_ratio: 0.03\n- num_epochs: 1",
"### Training results",
"### Framework versions\n\n- PEFT 0.10.0\n- Transformers 4.36.2\n- Pytorch 2.1.2+cu121\n- Datasets 2.16.1\n- Tokenizers 0.15.2"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | golf2248/vxli9uo | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T21:43:01+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
null | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | bradleyg223/sai_finetune | null | [
"transformers",
"safetensors",
"arxiv:1910.09700",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:43:21+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #arxiv-1910.09700 #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #arxiv-1910.09700 #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers |
## Model Details
We introduce Llama3-ChatQA-1.5, which excels at conversational question answering (QA) and retrieval-augmented generation (RAG). Llama3-ChatQA-1.5 is developed using an improved training recipe from [ChatQA (1.0)](https://arxiv.org/abs/2401.10225), and it is built on top of [Llama-3 base model](https://huggingface.co/meta-llama/Meta-Llama-3-8B). Specifically, we incorporate more conversational QA data to enhance its tabular and arithmetic calculation capability. Llama3-ChatQA-1.5 has two variants: Llama3-ChatQA-1.5-8B and Llama3-ChatQA-1.5-70B. Both models were originally trained using [Megatron-LM](https://github.com/NVIDIA/Megatron-LM), we converted the checkpoints to Hugging Face format.
## Other Resources
[Llama3-ChatQA-1.5-8B](https://huggingface.co/nvidia/Llama3-ChatQA-1.5-8B)   [Evaluation Data](https://huggingface.co/datasets/nvidia/ConvRAG-Bench)   [Training Data](https://huggingface.co/datasets/nvidia/ChatQA-Training-Data)   [Retriever](https://huggingface.co/nvidia/dragon-multiturn-query-encoder)
## Benchmark Results
Results in ConvRAG Bench are as follows:
| | ChatQA-1.0-7B | Command-R-Plus | Llama-3-instruct-70b | GPT-4-0613 | ChatQA-1.0-70B | ChatQA-1.5-8B | ChatQA-1.5-70B |
| -- |:--:|:--:|:--:|:--:|:--:|:--:|:--:|
| Doc2Dial | 37.88 | 33.51 | 37.88 | 34.16 | 38.9 | 39.33 | 41.26 |
| QuAC | 29.69 | 34.16 | 36.96 | 40.29 | 41.82 | 39.73 | 38.82 |
| QReCC | 46.97 | 49.77 | 51.34 | 52.01 | 48.05 | 49.03 | 51.40 |
| CoQA | 76.61 | 69.71 | 76.98 | 77.42 | 78.57 | 76.46 | 78.44 |
| DoQA | 41.57 | 40.67 | 41.24 | 43.39 | 51.94 | 49.6 | 50.67 |
| ConvFinQA | 51.61 | 71.21 | 76.6 | 81.28 | 73.69 | 78.46 | 81.88 |
| SQA | 61.87 | 74.07 | 69.61 | 79.21 | 69.14 | 73.28 | 83.82 |
| TopioCQA | 45.45 | 53.77 | 49.72 | 45.09 | 50.98 | 49.96 | 55.63 |
| HybriDial* | 54.51 | 46.7 | 48.59 | 49.81 | 56.44 | 65.76 | 68.27 |
| INSCIT | 30.96 | 35.76 | 36.23 | 36.34 | 31.9 | 30.1 | 32.31 |
| Average (all) | 47.71 | 50.93 | 52.52 | 53.90 | 54.14 | 55.17 | 58.25 |
| Average (exclude HybriDial) | 46.96 | 51.40 | 52.95 | 54.35 | 53.89 | 53.99 | 57.14 |
Note that ChatQA-1.5 is built based on Llama-3 base model, and ChatQA-1.0 is built based on Llama-2 base model. ChatQA-1.5 used some samples from the HybriDial training dataset. To ensure fair comparison, we also compare average scores excluding HybriDial. The data and evaluation scripts for ConvRAG can be found [here](https://huggingface.co/datasets/nvidia/ConvRAG-Bench).
## Prompt Format
<pre>
System: {System}
{Context}
User: {Question}
Assistant: {Response}
User: {Question}
Assistant:
</pre>
## How to use
### take the whole document as context
This can be applied to the scenario where the whole document can be fitted into the model, so that there is no need to run retrieval over the document.
```python
from transformers import AutoTokenizer, AutoModelForCausalLM
import torch
model_id = "nvidia/Llama3-ChatQA-1.5-70B"
tokenizer = AutoTokenizer.from_pretrained(model_id)
model = AutoModelForCausalLM.from_pretrained(model_id, torch_dtype=torch.float16, device_map="auto")
messages = [
{"role": "user", "content": "what is the percentage change of the net income from Q4 FY23 to Q4 FY24?"}
]
document = """NVIDIA (NASDAQ: NVDA) today reported revenue for the fourth quarter ended January 28, 2024, of $22.1 billion, up 22% from the previous quarter and up 265% from a year ago.\nFor the quarter, GAAP earnings per diluted share was $4.93, up 33% from the previous quarter and up 765% from a year ago. Non-GAAP earnings per diluted share was $5.16, up 28% from the previous quarter and up 486% from a year ago.\nQ4 Fiscal 2024 Summary\nGAAP\n| $ in millions, except earnings per share | Q4 FY24 | Q3 FY24 | Q4 FY23 | Q/Q | Y/Y |\n| Revenue | $22,103 | $18,120 | $6,051 | Up 22% | Up 265% |\n| Gross margin | 76.0% | 74.0% | 63.3% | Up 2.0 pts | Up 12.7 pts |\n| Operating expenses | $3,176 | $2,983 | $2,576 | Up 6% | Up 23% |\n| Operating income | $13,615 | $10,417 | $1,257 | Up 31% | Up 983% |\n| Net income | $12,285 | $9,243 | $1,414 | Up 33% | Up 769% |\n| Diluted earnings per share | $4.93 | $3.71 | $0.57 | Up 33% | Up 765% |"""
def get_formatted_input(messages, context):
system = "System: This is a chat between a user and an artificial intelligence assistant. The assistant gives helpful, detailed, and polite answers to the user's questions based on the context. The assistant should also indicate when the answer cannot be found in the context."
instruction = "Please give a full and complete answer for the question."
for item in messages:
if item['role'] == "user":
## only apply this instruction for the first user turn
item['content'] = instruction + " " + item['content']
break
conversation = '\n\n'.join(["User: " + item["content"] if item["role"] == "user" else "Assistant: " + item["content"] for item in messages]) + "\n\nAssistant:"
formatted_input = system + "\n\n" + context + "\n\n" + conversation
return formatted_input
formatted_input = get_formatted_input(messages, document)
tokenized_prompt = tokenizer(tokenizer.bos_token + formatted_input, return_tensors="pt").to(model.device)
terminators = [
tokenizer.eos_token_id,
tokenizer.convert_tokens_to_ids("<|eot_id|>")
]
outputs = model.generate(input_ids=tokenized_prompt.input_ids, attention_mask=tokenized_prompt.attention_mask, max_new_tokens=128, eos_token_id=terminators)
response = outputs[0][tokenized_prompt.input_ids.shape[-1]:]
print(tokenizer.decode(response, skip_special_tokens=True))
```
### run retrieval to get top-n chunks as context
This can be applied to the scenario when the document is very long, so that it is necessary to run retrieval. Here, we use our [Dragon-multiturn](https://huggingface.co/nvidia/dragon-multiturn-query-encoder) retriever which can handle conversatinoal query. In addition, we provide a few [documents](https://huggingface.co/nvidia/Llama3-ChatQA-1.5-70B/tree/main/docs) for users to play with.
```python
from transformers import AutoTokenizer, AutoModelForCausalLM, AutoModel
import torch
import json
## load ChatQA-1.5 tokenizer and model
model_id = "nvidia/Llama3-ChatQA-1.5-70B"
tokenizer = AutoTokenizer.from_pretrained(model_id)
model = AutoModelForCausalLM.from_pretrained(model_id, torch_dtype=torch.float16, device_map="auto")
## load retriever tokenizer and model
retriever_tokenizer = AutoTokenizer.from_pretrained('nvidia/dragon-multiturn-query-encoder')
query_encoder = AutoModel.from_pretrained('nvidia/dragon-multiturn-query-encoder')
context_encoder = AutoModel.from_pretrained('nvidia/dragon-multiturn-context-encoder')
## prepare documents, we take landrover car manual document that we provide as an example
chunk_list = json.load(open("docs.json"))['landrover']
messages = [
{"role": "user", "content": "how to connect the bluetooth in the car?"}
]
### running retrieval
## convert query into a format as follows:
## user: {user}\nagent: {agent}\nuser: {user}
formatted_query_for_retriever = '\n'.join([turn['role'] + ": " + turn['content'] for turn in messages]).strip()
query_input = retriever_tokenizer(formatted_query_for_retriever, return_tensors='pt')
ctx_input = retriever_tokenizer(chunk_list, padding=True, truncation=True, max_length=512, return_tensors='pt')
query_emb = query_encoder(**query_input).last_hidden_state[:, 0, :]
ctx_emb = context_encoder(**ctx_input).last_hidden_state[:, 0, :]
## Compute similarity scores using dot product and rank the similarity
similarities = query_emb.matmul(ctx_emb.transpose(0, 1)) # (1, num_ctx)
ranked_results = torch.argsort(similarities, dim=-1, descending=True) # (1, num_ctx)
## get top-n chunks (n=5)
retrieved_chunks = [chunk_list[idx] for idx in ranked_results.tolist()[0][:5]]
context = "\n\n".join(retrieved_chunks)
### running text generation
formatted_input = get_formatted_input(messages, context)
tokenized_prompt = tokenizer(tokenizer.bos_token + formatted_input, return_tensors="pt").to(model.device)
terminators = [
tokenizer.eos_token_id,
tokenizer.convert_tokens_to_ids("<|eot_id|>")
]
outputs = model.generate(input_ids=tokenized_prompt.input_ids, attention_mask=tokenized_prompt.attention_mask, max_new_tokens=128, eos_token_id=terminators)
response = outputs[0][tokenized_prompt.input_ids.shape[-1]:]
print(tokenizer.decode(response, skip_special_tokens=True))
```
## Correspondence to
Zihan Liu ([email protected]), Wei Ping ([email protected])
## Citation
<pre>
@article{liu2024chatqa,
title={ChatQA: Building GPT-4 Level Conversational QA Models},
author={Liu, Zihan and Ping, Wei and Roy, Rajarshi and Xu, Peng and Lee, Chankyu and Shoeybi, Mohammad and Catanzaro, Bryan},
journal={arXiv preprint arXiv:2401.10225},
year={2024}}
</pre>
## License
The use of this model is governed by the [META LLAMA 3 COMMUNITY LICENSE AGREEMENT](https://llama.meta.com/llama3/license/)
| {"language": ["en"], "license": "llama3", "tags": ["nvidia", "chatqa-1.5", "chatqa", "llama-3", "pytorch"], "pipeline_tag": "text-generation"} | nvidia/Llama3-ChatQA-1.5-70B | null | [
"transformers",
"pytorch",
"llama",
"text-generation",
"nvidia",
"chatqa-1.5",
"chatqa",
"llama-3",
"en",
"arxiv:2401.10225",
"license:llama3",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T21:44:57+00:00 | [
"2401.10225"
] | [
"en"
] | TAGS
#transformers #pytorch #llama #text-generation #nvidia #chatqa-1.5 #chatqa #llama-3 #en #arxiv-2401.10225 #license-llama3 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
| Model Details
-------------
We introduce Llama3-ChatQA-1.5, which excels at conversational question answering (QA) and retrieval-augmented generation (RAG). Llama3-ChatQA-1.5 is developed using an improved training recipe from ChatQA (1.0), and it is built on top of Llama-3 base model. Specifically, we incorporate more conversational QA data to enhance its tabular and arithmetic calculation capability. Llama3-ChatQA-1.5 has two variants: Llama3-ChatQA-1.5-8B and Llama3-ChatQA-1.5-70B. Both models were originally trained using Megatron-LM, we converted the checkpoints to Hugging Face format.
Other Resources
---------------
Llama3-ChatQA-1.5-8B Evaluation Data Training Data Retriever
Benchmark Results
-----------------
Results in ConvRAG Bench are as follows:
Note that ChatQA-1.5 is built based on Llama-3 base model, and ChatQA-1.0 is built based on Llama-2 base model. ChatQA-1.5 used some samples from the HybriDial training dataset. To ensure fair comparison, we also compare average scores excluding HybriDial. The data and evaluation scripts for ConvRAG can be found here.
Prompt Format
-------------
```
System: {System}
{Context}
User: {Question}
Assistant: {Response}
User: {Question}
Assistant:
```
How to use
----------
### take the whole document as context
This can be applied to the scenario where the whole document can be fitted into the model, so that there is no need to run retrieval over the document.
### run retrieval to get top-n chunks as context
This can be applied to the scenario when the document is very long, so that it is necessary to run retrieval. Here, we use our Dragon-multiturn retriever which can handle conversatinoal query. In addition, we provide a few documents for users to play with.
Correspondence to
-----------------
Zihan Liu (zihanl@URL), Wei Ping (wping@URL)
```
@article{liu2024chatqa,
title={ChatQA: Building GPT-4 Level Conversational QA Models},
author={Liu, Zihan and Ping, Wei and Roy, Rajarshi and Xu, Peng and Lee, Chankyu and Shoeybi, Mohammad and Catanzaro, Bryan},
journal={arXiv preprint arXiv:2401.10225},
year={2024}}
```
License
-------
The use of this model is governed by the META LLAMA 3 COMMUNITY LICENSE AGREEMENT
| [
"### take the whole document as context\n\n\nThis can be applied to the scenario where the whole document can be fitted into the model, so that there is no need to run retrieval over the document.",
"### run retrieval to get top-n chunks as context\n\n\nThis can be applied to the scenario when the document is very long, so that it is necessary to run retrieval. Here, we use our Dragon-multiturn retriever which can handle conversatinoal query. In addition, we provide a few documents for users to play with.\n\n\nCorrespondence to\n-----------------\n\n\nZihan Liu (zihanl@URL), Wei Ping (wping@URL)\n\n\n\n```\n\n@article{liu2024chatqa,\n title={ChatQA: Building GPT-4 Level Conversational QA Models},\n author={Liu, Zihan and Ping, Wei and Roy, Rajarshi and Xu, Peng and Lee, Chankyu and Shoeybi, Mohammad and Catanzaro, Bryan},\n journal={arXiv preprint arXiv:2401.10225},\n year={2024}}\n\n```\n\nLicense\n-------\n\n\nThe use of this model is governed by the META LLAMA 3 COMMUNITY LICENSE AGREEMENT"
] | [
"TAGS\n#transformers #pytorch #llama #text-generation #nvidia #chatqa-1.5 #chatqa #llama-3 #en #arxiv-2401.10225 #license-llama3 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"### take the whole document as context\n\n\nThis can be applied to the scenario where the whole document can be fitted into the model, so that there is no need to run retrieval over the document.",
"### run retrieval to get top-n chunks as context\n\n\nThis can be applied to the scenario when the document is very long, so that it is necessary to run retrieval. Here, we use our Dragon-multiturn retriever which can handle conversatinoal query. In addition, we provide a few documents for users to play with.\n\n\nCorrespondence to\n-----------------\n\n\nZihan Liu (zihanl@URL), Wei Ping (wping@URL)\n\n\n\n```\n\n@article{liu2024chatqa,\n title={ChatQA: Building GPT-4 Level Conversational QA Models},\n author={Liu, Zihan and Ping, Wei and Roy, Rajarshi and Xu, Peng and Lee, Chankyu and Shoeybi, Mohammad and Catanzaro, Bryan},\n journal={arXiv preprint arXiv:2401.10225},\n year={2024}}\n\n```\n\nLicense\n-------\n\n\nThe use of this model is governed by the META LLAMA 3 COMMUNITY LICENSE AGREEMENT"
] |
text2text-generation | transformers |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# t5-small-finetuned-wikisql
This model is a fine-tuned version of [t5-small](https://huggingface.co/t5-small) on an unknown dataset.
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 5e-05
- train_batch_size: 16
- eval_batch_size: 16
- seed: 42
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: linear
- num_epochs: 2
### Framework versions
- Transformers 4.30.0
- Pytorch 2.2.1+cu121
- Datasets 2.19.0
- Tokenizers 0.13.3
| {"license": "apache-2.0", "tags": ["generated_from_trainer"], "model-index": [{"name": "t5-small-finetuned-wikisql", "results": []}]} | MrinmoySaikia/t5-small-finetuned-wikisql | null | [
"transformers",
"pytorch",
"tensorboard",
"t5",
"text2text-generation",
"generated_from_trainer",
"license:apache-2.0",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T21:45:00+00:00 | [] | [] | TAGS
#transformers #pytorch #tensorboard #t5 #text2text-generation #generated_from_trainer #license-apache-2.0 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
|
# t5-small-finetuned-wikisql
This model is a fine-tuned version of t5-small on an unknown dataset.
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 5e-05
- train_batch_size: 16
- eval_batch_size: 16
- seed: 42
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: linear
- num_epochs: 2
### Framework versions
- Transformers 4.30.0
- Pytorch 2.2.1+cu121
- Datasets 2.19.0
- Tokenizers 0.13.3
| [
"# t5-small-finetuned-wikisql\n\nThis model is a fine-tuned version of t5-small on an unknown dataset.",
"## Model description\n\nMore information needed",
"## Intended uses & limitations\n\nMore information needed",
"## Training and evaluation data\n\nMore information needed",
"## Training procedure",
"### Training hyperparameters\n\nThe following hyperparameters were used during training:\n- learning_rate: 5e-05\n- train_batch_size: 16\n- eval_batch_size: 16\n- seed: 42\n- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n- lr_scheduler_type: linear\n- num_epochs: 2",
"### Framework versions\n\n- Transformers 4.30.0\n- Pytorch 2.2.1+cu121\n- Datasets 2.19.0\n- Tokenizers 0.13.3"
] | [
"TAGS\n#transformers #pytorch #tensorboard #t5 #text2text-generation #generated_from_trainer #license-apache-2.0 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# t5-small-finetuned-wikisql\n\nThis model is a fine-tuned version of t5-small on an unknown dataset.",
"## Model description\n\nMore information needed",
"## Intended uses & limitations\n\nMore information needed",
"## Training and evaluation data\n\nMore information needed",
"## Training procedure",
"### Training hyperparameters\n\nThe following hyperparameters were used during training:\n- learning_rate: 5e-05\n- train_batch_size: 16\n- eval_batch_size: 16\n- seed: 42\n- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n- lr_scheduler_type: linear\n- num_epochs: 2",
"### Framework versions\n\n- Transformers 4.30.0\n- Pytorch 2.2.1+cu121\n- Datasets 2.19.0\n- Tokenizers 0.13.3"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | GamblerOnTrain/ABF003 | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T21:46:44+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | GamblerOnTrain/ABF002 | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T21:46:49+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | OwOOwO/finalc1 | null | [
"transformers",
"safetensors",
"stablelm",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:48:37+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #stablelm #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #stablelm #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-to-image | diffusers |
<!-- This model card has been generated automatically according to the information the training script had access to. You
should probably proofread and complete it, then remove this comment. -->
# Textual inversion text2image fine-tuning - janetsw/par
These are textual inversion adaption weights for stabilityai/stable-diffusion-2-1-base. You can find some example images in the following.
## Intended uses & limitations
#### How to use
```python
# TODO: add an example code snippet for running this diffusion pipeline
```
#### Limitations and bias
[TODO: provide examples of latent issues and potential remediations]
## Training details
[TODO: describe the data used to train the model] | {"license": "creativeml-openrail-m", "library_name": "diffusers", "tags": ["stable-diffusion", "stable-diffusion-diffusers", "text-to-image", "diffusers", "textual_inversion", "diffusers-training"], "base_model": "stabilityai/stable-diffusion-2-1-base", "inference": true} | janetsw/par | null | [
"diffusers",
"tensorboard",
"safetensors",
"stable-diffusion",
"stable-diffusion-diffusers",
"text-to-image",
"textual_inversion",
"diffusers-training",
"base_model:stabilityai/stable-diffusion-2-1-base",
"license:creativeml-openrail-m",
"endpoints_compatible",
"diffusers:StableDiffusionPipeline",
"region:us"
] | null | 2024-04-28T21:52:02+00:00 | [] | [] | TAGS
#diffusers #tensorboard #safetensors #stable-diffusion #stable-diffusion-diffusers #text-to-image #textual_inversion #diffusers-training #base_model-stabilityai/stable-diffusion-2-1-base #license-creativeml-openrail-m #endpoints_compatible #diffusers-StableDiffusionPipeline #region-us
|
# Textual inversion text2image fine-tuning - janetsw/par
These are textual inversion adaption weights for stabilityai/stable-diffusion-2-1-base. You can find some example images in the following.
## Intended uses & limitations
#### How to use
#### Limitations and bias
[TODO: provide examples of latent issues and potential remediations]
## Training details
[TODO: describe the data used to train the model] | [
"# Textual inversion text2image fine-tuning - janetsw/par\nThese are textual inversion adaption weights for stabilityai/stable-diffusion-2-1-base. You can find some example images in the following.",
"## Intended uses & limitations",
"#### How to use",
"#### Limitations and bias\n\n[TODO: provide examples of latent issues and potential remediations]",
"## Training details\n\n[TODO: describe the data used to train the model]"
] | [
"TAGS\n#diffusers #tensorboard #safetensors #stable-diffusion #stable-diffusion-diffusers #text-to-image #textual_inversion #diffusers-training #base_model-stabilityai/stable-diffusion-2-1-base #license-creativeml-openrail-m #endpoints_compatible #diffusers-StableDiffusionPipeline #region-us \n",
"# Textual inversion text2image fine-tuning - janetsw/par\nThese are textual inversion adaption weights for stabilityai/stable-diffusion-2-1-base. You can find some example images in the following.",
"## Intended uses & limitations",
"#### How to use",
"#### Limitations and bias\n\n[TODO: provide examples of latent issues and potential remediations]",
"## Training details\n\n[TODO: describe the data used to train the model]"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | pruning/st2uah3 | null | [
"transformers",
"safetensors",
"stablelm",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:52:07+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #stablelm #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #stablelm #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers | # Undi95/Llama-3-LewdPlay-8B-evo AWQ
- Model creator: [Undi95](https://huggingface.co/Undi95)
- Original model: [Llama-3-LewdPlay-8B-evo](https://huggingface.co/Undi95/Llama-3-LewdPlay-8B-evo)
## Model Summary
This is a merge of pre-trained language models created using [mergekit](https://github.com/cg123/mergekit).
The new EVOLVE merge method was used (on MMLU specifically), see below for more information!
Unholy was used for uncensoring, Roleplay Llama 3 for the DPO train he got on top, and LewdPlay for the... lewd side.
## How to use
### Prompt template: Llama3
```
<|begin_of_text|><|start_header_id|>system<|end_header_id|>
{system_prompt}<|eot_id|><|start_header_id|>user<|end_header_id|>
{input}<|eot_id|><|start_header_id|>assistant<|end_header_id|>
{output}<|eot_id|>
```
### Install the necessary packages
```bash
pip install --upgrade autoawq autoawq-kernels
```
### Example Python code
```python
from awq import AutoAWQForCausalLM
from transformers import AutoTokenizer, TextStreamer
model_path = "solidrust/Llama-3-LewdPlay-8B-evo-AWQ"
system_message = "You are Llama-3-LewdPlay-8B-evo, incarnated as a powerful AI. You were created by Undi95."
# Load model
model = AutoAWQForCausalLM.from_quantized(model_path,
fuse_layers=True)
tokenizer = AutoTokenizer.from_pretrained(model_path,
trust_remote_code=True)
streamer = TextStreamer(tokenizer,
skip_prompt=True,
skip_special_tokens=True)
# Convert prompt to tokens
prompt_template = """\
<|im_start|>system
{system_message}<|im_end|>
<|im_start|>user
{prompt}<|im_end|>
<|im_start|>assistant"""
prompt = "You're standing on the surface of the Earth. "\
"You walk one mile south, one mile west and one mile north. "\
"You end up exactly where you started. Where are you?"
tokens = tokenizer(prompt_template.format(system_message=system_message,prompt=prompt),
return_tensors='pt').input_ids.cuda()
# Generate output
generation_output = model.generate(tokens,
streamer=streamer,
max_new_tokens=512)
```
### About AWQ
AWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.
AWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.
It is supported by:
- [Text Generation Webui](https://github.com/oobabooga/text-generation-webui) - using Loader: AutoAWQ
- [vLLM](https://github.com/vllm-project/vllm) - version 0.2.2 or later for support for all model types.
- [Hugging Face Text Generation Inference (TGI)](https://github.com/huggingface/text-generation-inference)
- [Transformers](https://huggingface.co/docs/transformers) version 4.35.0 and later, from any code or client that supports Transformers
- [AutoAWQ](https://github.com/casper-hansen/AutoAWQ) - for use from Python code
| {"license": "cc-by-nc-4.0", "library_name": "transformers", "tags": ["mergekit", "merge", "4-bit", "AWQ", "text-generation", "autotrain_compatible", "endpoints_compatible"], "base_model": ["vicgalle/Roleplay-Llama-3-8B", "Undi95/Llama-3-Unholy-8B-e4", "Undi95/Llama-3-LewdPlay-8B"], "pipeline_tag": "text-generation", "inference": false, "quantized_by": "Suparious"} | solidrust/Llama-3-LewdPlay-8B-evo-AWQ | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"mergekit",
"merge",
"4-bit",
"AWQ",
"autotrain_compatible",
"endpoints_compatible",
"conversational",
"base_model:vicgalle/Roleplay-Llama-3-8B",
"base_model:Undi95/Llama-3-Unholy-8B-e4",
"base_model:Undi95/Llama-3-LewdPlay-8B",
"license:cc-by-nc-4.0",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T21:52:39+00:00 | [] | [] | TAGS
#transformers #safetensors #llama #text-generation #mergekit #merge #4-bit #AWQ #autotrain_compatible #endpoints_compatible #conversational #base_model-vicgalle/Roleplay-Llama-3-8B #base_model-Undi95/Llama-3-Unholy-8B-e4 #base_model-Undi95/Llama-3-LewdPlay-8B #license-cc-by-nc-4.0 #text-generation-inference #region-us
| # Undi95/Llama-3-LewdPlay-8B-evo AWQ
- Model creator: Undi95
- Original model: Llama-3-LewdPlay-8B-evo
## Model Summary
This is a merge of pre-trained language models created using mergekit.
The new EVOLVE merge method was used (on MMLU specifically), see below for more information!
Unholy was used for uncensoring, Roleplay Llama 3 for the DPO train he got on top, and LewdPlay for the... lewd side.
## How to use
### Prompt template: Llama3
### Install the necessary packages
### Example Python code
### About AWQ
AWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.
AWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.
It is supported by:
- Text Generation Webui - using Loader: AutoAWQ
- vLLM - version 0.2.2 or later for support for all model types.
- Hugging Face Text Generation Inference (TGI)
- Transformers version 4.35.0 and later, from any code or client that supports Transformers
- AutoAWQ - for use from Python code
| [
"# Undi95/Llama-3-LewdPlay-8B-evo AWQ\n\n- Model creator: Undi95\n- Original model: Llama-3-LewdPlay-8B-evo",
"## Model Summary\n\nThis is a merge of pre-trained language models created using mergekit.\n\nThe new EVOLVE merge method was used (on MMLU specifically), see below for more information!\n\nUnholy was used for uncensoring, Roleplay Llama 3 for the DPO train he got on top, and LewdPlay for the... lewd side.",
"## How to use",
"### Prompt template: Llama3",
"### Install the necessary packages",
"### Example Python code",
"### About AWQ\n\nAWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.\n\nAWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.\n\nIt is supported by:\n\n- Text Generation Webui - using Loader: AutoAWQ\n- vLLM - version 0.2.2 or later for support for all model types.\n- Hugging Face Text Generation Inference (TGI)\n- Transformers version 4.35.0 and later, from any code or client that supports Transformers\n- AutoAWQ - for use from Python code"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #mergekit #merge #4-bit #AWQ #autotrain_compatible #endpoints_compatible #conversational #base_model-vicgalle/Roleplay-Llama-3-8B #base_model-Undi95/Llama-3-Unholy-8B-e4 #base_model-Undi95/Llama-3-LewdPlay-8B #license-cc-by-nc-4.0 #text-generation-inference #region-us \n",
"# Undi95/Llama-3-LewdPlay-8B-evo AWQ\n\n- Model creator: Undi95\n- Original model: Llama-3-LewdPlay-8B-evo",
"## Model Summary\n\nThis is a merge of pre-trained language models created using mergekit.\n\nThe new EVOLVE merge method was used (on MMLU specifically), see below for more information!\n\nUnholy was used for uncensoring, Roleplay Llama 3 for the DPO train he got on top, and LewdPlay for the... lewd side.",
"## How to use",
"### Prompt template: Llama3",
"### Install the necessary packages",
"### Example Python code",
"### About AWQ\n\nAWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.\n\nAWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.\n\nIt is supported by:\n\n- Text Generation Webui - using Loader: AutoAWQ\n- vLLM - version 0.2.2 or later for support for all model types.\n- Hugging Face Text Generation Inference (TGI)\n- Transformers version 4.35.0 and later, from any code or client that supports Transformers\n- AutoAWQ - for use from Python code"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | shallow6414/ly3f777 | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T21:53:51+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | golf2248/mc1nxga | null | [
"transformers",
"safetensors",
"stablelm",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:54:42+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #stablelm #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #stablelm #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | liquid9212/dajxf8b | null | [
"transformers",
"safetensors",
"stablelm",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:54:42+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #stablelm #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #stablelm #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
null | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | Aaron82352/length_generalization_testing_ABC_100steps_masking_prompt | null | [
"transformers",
"safetensors",
"arxiv:1910.09700",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T21:56:53+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #arxiv-1910.09700 #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #arxiv-1910.09700 #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
null | null |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# G0428HMA17
This model is a fine-tuned version of [google/gemma-2b](https://huggingface.co/google/gemma-2b) on an unknown dataset.
It achieves the following results on the evaluation set:
- Loss: 0.1475
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 0.0003
- train_batch_size: 8
- eval_batch_size: 8
- seed: 42
- gradient_accumulation_steps: 16
- total_train_batch_size: 128
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: cosine_with_restarts
- lr_scheduler_warmup_steps: 60
- num_epochs: 3
- mixed_precision_training: Native AMP
### Training results
| Training Loss | Epoch | Step | Validation Loss |
|:-------------:|:-----:|:----:|:---------------:|
| 2.4638 | 0.09 | 10 | 1.3793 |
| 0.7418 | 0.18 | 20 | 0.2028 |
| 0.1674 | 0.27 | 30 | 0.1537 |
| 0.1515 | 0.36 | 40 | 0.1513 |
| 0.1467 | 0.45 | 50 | 0.1468 |
| 0.1476 | 0.54 | 60 | 0.1490 |
| 0.1497 | 0.63 | 70 | 0.1493 |
| 0.1505 | 0.73 | 80 | 0.1493 |
| 0.1436 | 0.82 | 90 | 0.1560 |
| 0.1488 | 0.91 | 100 | 0.1536 |
| 0.1518 | 1.0 | 110 | 0.1515 |
| 0.1436 | 1.09 | 120 | 0.1541 |
| 0.1891 | 1.18 | 130 | 0.1701 |
| 0.1629 | 1.27 | 140 | 0.1505 |
| 0.1532 | 1.36 | 150 | 0.1500 |
| 0.1458 | 1.45 | 160 | 0.1529 |
| 0.1515 | 1.54 | 170 | 0.1505 |
| 0.1493 | 1.63 | 180 | 0.1487 |
| 0.1484 | 1.72 | 190 | 0.1506 |
| 0.1474 | 1.81 | 200 | 0.1488 |
| 0.1484 | 1.9 | 210 | 0.1474 |
| 0.1477 | 1.99 | 220 | 0.1485 |
| 0.1459 | 2.08 | 230 | 0.1478 |
| 0.1467 | 2.18 | 240 | 0.1494 |
| 0.1459 | 2.27 | 250 | 0.1479 |
| 0.1471 | 2.36 | 260 | 0.1482 |
| 0.1446 | 2.45 | 270 | 0.1478 |
| 0.144 | 2.54 | 280 | 0.1479 |
| 0.1445 | 2.63 | 290 | 0.1478 |
| 0.1455 | 2.72 | 300 | 0.1476 |
| 0.1459 | 2.81 | 310 | 0.1475 |
| 0.1454 | 2.9 | 320 | 0.1475 |
| 0.1467 | 2.99 | 330 | 0.1475 |
### Framework versions
- Transformers 4.36.0.dev0
- Pytorch 2.1.2+cu121
- Datasets 2.14.6
- Tokenizers 0.14.1
| {"license": "gemma", "tags": ["generated_from_trainer"], "base_model": "google/gemma-2b", "model-index": [{"name": "G0428HMA17", "results": []}]} | Litzy619/G0428HMA17 | null | [
"safetensors",
"generated_from_trainer",
"base_model:google/gemma-2b",
"license:gemma",
"region:us"
] | null | 2024-04-28T22:01:09+00:00 | [] | [] | TAGS
#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us
| G0428HMA17
==========
This model is a fine-tuned version of google/gemma-2b on an unknown dataset.
It achieves the following results on the evaluation set:
* Loss: 0.1475
Model description
-----------------
More information needed
Intended uses & limitations
---------------------------
More information needed
Training and evaluation data
----------------------------
More information needed
Training procedure
------------------
### Training hyperparameters
The following hyperparameters were used during training:
* learning\_rate: 0.0003
* train\_batch\_size: 8
* eval\_batch\_size: 8
* seed: 42
* gradient\_accumulation\_steps: 16
* total\_train\_batch\_size: 128
* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
* lr\_scheduler\_type: cosine\_with\_restarts
* lr\_scheduler\_warmup\_steps: 60
* num\_epochs: 3
* mixed\_precision\_training: Native AMP
### Training results
### Framework versions
* Transformers 4.36.0.dev0
* Pytorch 2.1.2+cu121
* Datasets 2.14.6
* Tokenizers 0.14.1
| [
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 60\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] | [
"TAGS\n#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us \n",
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 60\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] |
null | null |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# G0428HMA18
This model is a fine-tuned version of [google/gemma-2b](https://huggingface.co/google/gemma-2b) on an unknown dataset.
It achieves the following results on the evaluation set:
- Loss: 0.1475
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 0.0003
- train_batch_size: 8
- eval_batch_size: 8
- seed: 42
- gradient_accumulation_steps: 16
- total_train_batch_size: 128
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: cosine_with_restarts
- lr_scheduler_warmup_steps: 60
- num_epochs: 3
- mixed_precision_training: Native AMP
### Training results
| Training Loss | Epoch | Step | Validation Loss |
|:-------------:|:-----:|:----:|:---------------:|
| 2.4638 | 0.09 | 10 | 1.3793 |
| 0.7418 | 0.18 | 20 | 0.2028 |
| 0.1674 | 0.27 | 30 | 0.1537 |
| 0.1515 | 0.36 | 40 | 0.1513 |
| 0.1467 | 0.45 | 50 | 0.1468 |
| 0.1476 | 0.54 | 60 | 0.1490 |
| 0.1497 | 0.63 | 70 | 0.1493 |
| 0.1505 | 0.73 | 80 | 0.1493 |
| 0.1436 | 0.82 | 90 | 0.1560 |
| 0.1488 | 0.91 | 100 | 0.1536 |
| 0.1518 | 1.0 | 110 | 0.1515 |
| 0.1436 | 1.09 | 120 | 0.1541 |
| 0.1891 | 1.18 | 130 | 0.1701 |
| 0.1629 | 1.27 | 140 | 0.1505 |
| 0.1532 | 1.36 | 150 | 0.1500 |
| 0.1458 | 1.45 | 160 | 0.1529 |
| 0.1515 | 1.54 | 170 | 0.1505 |
| 0.1493 | 1.63 | 180 | 0.1487 |
| 0.1484 | 1.72 | 190 | 0.1506 |
| 0.1474 | 1.81 | 200 | 0.1488 |
| 0.1484 | 1.9 | 210 | 0.1474 |
| 0.1477 | 1.99 | 220 | 0.1485 |
| 0.1459 | 2.08 | 230 | 0.1478 |
| 0.1467 | 2.18 | 240 | 0.1494 |
| 0.1459 | 2.27 | 250 | 0.1479 |
| 0.1471 | 2.36 | 260 | 0.1482 |
| 0.1446 | 2.45 | 270 | 0.1478 |
| 0.144 | 2.54 | 280 | 0.1479 |
| 0.1445 | 2.63 | 290 | 0.1478 |
| 0.1455 | 2.72 | 300 | 0.1476 |
| 0.1459 | 2.81 | 310 | 0.1475 |
| 0.1454 | 2.9 | 320 | 0.1475 |
| 0.1467 | 2.99 | 330 | 0.1475 |
### Framework versions
- Transformers 4.36.0.dev0
- Pytorch 2.1.2+cu121
- Datasets 2.14.6
- Tokenizers 0.14.1
| {"license": "gemma", "tags": ["generated_from_trainer"], "base_model": "google/gemma-2b", "model-index": [{"name": "G0428HMA18", "results": []}]} | Litzy619/G0428HMA18 | null | [
"safetensors",
"generated_from_trainer",
"base_model:google/gemma-2b",
"license:gemma",
"region:us"
] | null | 2024-04-28T22:01:24+00:00 | [] | [] | TAGS
#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us
| G0428HMA18
==========
This model is a fine-tuned version of google/gemma-2b on an unknown dataset.
It achieves the following results on the evaluation set:
* Loss: 0.1475
Model description
-----------------
More information needed
Intended uses & limitations
---------------------------
More information needed
Training and evaluation data
----------------------------
More information needed
Training procedure
------------------
### Training hyperparameters
The following hyperparameters were used during training:
* learning\_rate: 0.0003
* train\_batch\_size: 8
* eval\_batch\_size: 8
* seed: 42
* gradient\_accumulation\_steps: 16
* total\_train\_batch\_size: 128
* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
* lr\_scheduler\_type: cosine\_with\_restarts
* lr\_scheduler\_warmup\_steps: 60
* num\_epochs: 3
* mixed\_precision\_training: Native AMP
### Training results
### Framework versions
* Transformers 4.36.0.dev0
* Pytorch 2.1.2+cu121
* Datasets 2.14.6
* Tokenizers 0.14.1
| [
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 60\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] | [
"TAGS\n#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us \n",
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 60\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] |
null | null |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# G0428HMA19
This model is a fine-tuned version of [google/gemma-2b](https://huggingface.co/google/gemma-2b) on an unknown dataset.
It achieves the following results on the evaluation set:
- Loss: 0.1475
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 0.0003
- train_batch_size: 8
- eval_batch_size: 8
- seed: 42
- gradient_accumulation_steps: 16
- total_train_batch_size: 128
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: cosine_with_restarts
- lr_scheduler_warmup_steps: 60
- num_epochs: 3
- mixed_precision_training: Native AMP
### Training results
| Training Loss | Epoch | Step | Validation Loss |
|:-------------:|:-----:|:----:|:---------------:|
| 2.4638 | 0.09 | 10 | 1.3793 |
| 0.7418 | 0.18 | 20 | 0.2028 |
| 0.1674 | 0.27 | 30 | 0.1537 |
| 0.1515 | 0.36 | 40 | 0.1513 |
| 0.1467 | 0.45 | 50 | 0.1468 |
| 0.1476 | 0.54 | 60 | 0.1490 |
| 0.1497 | 0.63 | 70 | 0.1493 |
| 0.1505 | 0.73 | 80 | 0.1493 |
| 0.1436 | 0.82 | 90 | 0.1560 |
| 0.1488 | 0.91 | 100 | 0.1536 |
| 0.1518 | 1.0 | 110 | 0.1515 |
| 0.1436 | 1.09 | 120 | 0.1541 |
| 0.1891 | 1.18 | 130 | 0.1701 |
| 0.1629 | 1.27 | 140 | 0.1505 |
| 0.1532 | 1.36 | 150 | 0.1500 |
| 0.1458 | 1.45 | 160 | 0.1529 |
| 0.1515 | 1.54 | 170 | 0.1505 |
| 0.1493 | 1.63 | 180 | 0.1487 |
| 0.1484 | 1.72 | 190 | 0.1506 |
| 0.1474 | 1.81 | 200 | 0.1488 |
| 0.1484 | 1.9 | 210 | 0.1474 |
| 0.1477 | 1.99 | 220 | 0.1485 |
| 0.1459 | 2.08 | 230 | 0.1478 |
| 0.1467 | 2.18 | 240 | 0.1494 |
| 0.1459 | 2.27 | 250 | 0.1479 |
| 0.1471 | 2.36 | 260 | 0.1482 |
| 0.1446 | 2.45 | 270 | 0.1478 |
| 0.144 | 2.54 | 280 | 0.1479 |
| 0.1445 | 2.63 | 290 | 0.1478 |
| 0.1455 | 2.72 | 300 | 0.1476 |
| 0.1459 | 2.81 | 310 | 0.1475 |
| 0.1454 | 2.9 | 320 | 0.1475 |
| 0.1467 | 2.99 | 330 | 0.1475 |
### Framework versions
- Transformers 4.36.0.dev0
- Pytorch 2.1.2+cu121
- Datasets 2.14.6
- Tokenizers 0.14.1
| {"license": "gemma", "tags": ["generated_from_trainer"], "base_model": "google/gemma-2b", "model-index": [{"name": "G0428HMA19", "results": []}]} | Litzy619/G0428HMA19 | null | [
"safetensors",
"generated_from_trainer",
"base_model:google/gemma-2b",
"license:gemma",
"region:us"
] | null | 2024-04-28T22:01:38+00:00 | [] | [] | TAGS
#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us
| G0428HMA19
==========
This model is a fine-tuned version of google/gemma-2b on an unknown dataset.
It achieves the following results on the evaluation set:
* Loss: 0.1475
Model description
-----------------
More information needed
Intended uses & limitations
---------------------------
More information needed
Training and evaluation data
----------------------------
More information needed
Training procedure
------------------
### Training hyperparameters
The following hyperparameters were used during training:
* learning\_rate: 0.0003
* train\_batch\_size: 8
* eval\_batch\_size: 8
* seed: 42
* gradient\_accumulation\_steps: 16
* total\_train\_batch\_size: 128
* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
* lr\_scheduler\_type: cosine\_with\_restarts
* lr\_scheduler\_warmup\_steps: 60
* num\_epochs: 3
* mixed\_precision\_training: Native AMP
### Training results
### Framework versions
* Transformers 4.36.0.dev0
* Pytorch 2.1.2+cu121
* Datasets 2.14.6
* Tokenizers 0.14.1
| [
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 60\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] | [
"TAGS\n#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us \n",
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 60\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] |
null | null |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# G0428HMA20
This model is a fine-tuned version of [google/gemma-2b](https://huggingface.co/google/gemma-2b) on an unknown dataset.
It achieves the following results on the evaluation set:
- Loss: 0.1475
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 0.0003
- train_batch_size: 8
- eval_batch_size: 8
- seed: 42
- gradient_accumulation_steps: 16
- total_train_batch_size: 128
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: cosine_with_restarts
- lr_scheduler_warmup_steps: 60
- num_epochs: 3
- mixed_precision_training: Native AMP
### Training results
| Training Loss | Epoch | Step | Validation Loss |
|:-------------:|:-----:|:----:|:---------------:|
| 2.4638 | 0.09 | 10 | 1.3793 |
| 0.7418 | 0.18 | 20 | 0.2028 |
| 0.1674 | 0.27 | 30 | 0.1537 |
| 0.1515 | 0.36 | 40 | 0.1513 |
| 0.1467 | 0.45 | 50 | 0.1468 |
| 0.1476 | 0.54 | 60 | 0.1490 |
| 0.1497 | 0.63 | 70 | 0.1493 |
| 0.1505 | 0.73 | 80 | 0.1493 |
| 0.1436 | 0.82 | 90 | 0.1560 |
| 0.1488 | 0.91 | 100 | 0.1536 |
| 0.1518 | 1.0 | 110 | 0.1515 |
| 0.1436 | 1.09 | 120 | 0.1541 |
| 0.1891 | 1.18 | 130 | 0.1701 |
| 0.1629 | 1.27 | 140 | 0.1505 |
| 0.1532 | 1.36 | 150 | 0.1500 |
| 0.1458 | 1.45 | 160 | 0.1529 |
| 0.1515 | 1.54 | 170 | 0.1505 |
| 0.1493 | 1.63 | 180 | 0.1487 |
| 0.1484 | 1.72 | 190 | 0.1506 |
| 0.1474 | 1.81 | 200 | 0.1488 |
| 0.1484 | 1.9 | 210 | 0.1474 |
| 0.1477 | 1.99 | 220 | 0.1485 |
| 0.1459 | 2.08 | 230 | 0.1478 |
| 0.1467 | 2.18 | 240 | 0.1494 |
| 0.1459 | 2.27 | 250 | 0.1479 |
| 0.1471 | 2.36 | 260 | 0.1482 |
| 0.1446 | 2.45 | 270 | 0.1478 |
| 0.144 | 2.54 | 280 | 0.1479 |
| 0.1445 | 2.63 | 290 | 0.1478 |
| 0.1455 | 2.72 | 300 | 0.1476 |
| 0.1459 | 2.81 | 310 | 0.1475 |
| 0.1454 | 2.9 | 320 | 0.1475 |
| 0.1467 | 2.99 | 330 | 0.1475 |
### Framework versions
- Transformers 4.36.0.dev0
- Pytorch 2.1.2+cu121
- Datasets 2.14.6
- Tokenizers 0.14.1
| {"license": "gemma", "tags": ["generated_from_trainer"], "base_model": "google/gemma-2b", "model-index": [{"name": "G0428HMA20", "results": []}]} | Litzy619/G0428HMA20 | null | [
"safetensors",
"generated_from_trainer",
"base_model:google/gemma-2b",
"license:gemma",
"region:us"
] | null | 2024-04-28T22:02:04+00:00 | [] | [] | TAGS
#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us
| G0428HMA20
==========
This model is a fine-tuned version of google/gemma-2b on an unknown dataset.
It achieves the following results on the evaluation set:
* Loss: 0.1475
Model description
-----------------
More information needed
Intended uses & limitations
---------------------------
More information needed
Training and evaluation data
----------------------------
More information needed
Training procedure
------------------
### Training hyperparameters
The following hyperparameters were used during training:
* learning\_rate: 0.0003
* train\_batch\_size: 8
* eval\_batch\_size: 8
* seed: 42
* gradient\_accumulation\_steps: 16
* total\_train\_batch\_size: 128
* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
* lr\_scheduler\_type: cosine\_with\_restarts
* lr\_scheduler\_warmup\_steps: 60
* num\_epochs: 3
* mixed\_precision\_training: Native AMP
### Training results
### Framework versions
* Transformers 4.36.0.dev0
* Pytorch 2.1.2+cu121
* Datasets 2.14.6
* Tokenizers 0.14.1
| [
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 60\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] | [
"TAGS\n#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us \n",
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 60\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] |
reinforcement-learning | sample-factory |
A(n) **APPO** model trained on the **doom_health_gathering_supreme** environment.
This model was trained using Sample-Factory 2.0: https://github.com/alex-petrenko/sample-factory.
Documentation for how to use Sample-Factory can be found at https://www.samplefactory.dev/
## Downloading the model
After installing Sample-Factory, download the model with:
```
python -m sample_factory.huggingface.load_from_hub -r HusseinEid/rl_course_vizdoom_health_gathering_supreme
```
## Using the model
To run the model after download, use the `enjoy` script corresponding to this environment:
```
python -m .usr.local.lib.python3.10.dist-packages.colab_kernel_launcher --algo=APPO --env=doom_health_gathering_supreme --train_dir=./train_dir --experiment=rl_course_vizdoom_health_gathering_supreme
```
You can also upload models to the Hugging Face Hub using the same script with the `--push_to_hub` flag.
See https://www.samplefactory.dev/10-huggingface/huggingface/ for more details
## Training with this model
To continue training with this model, use the `train` script corresponding to this environment:
```
python -m .usr.local.lib.python3.10.dist-packages.colab_kernel_launcher --algo=APPO --env=doom_health_gathering_supreme --train_dir=./train_dir --experiment=rl_course_vizdoom_health_gathering_supreme --restart_behavior=resume --train_for_env_steps=10000000000
```
Note, you may have to adjust `--train_for_env_steps` to a suitably high number as the experiment will resume at the number of steps it concluded at.
| {"library_name": "sample-factory", "tags": ["deep-reinforcement-learning", "reinforcement-learning", "sample-factory"], "model-index": [{"name": "APPO", "results": [{"task": {"type": "reinforcement-learning", "name": "reinforcement-learning"}, "dataset": {"name": "doom_health_gathering_supreme", "type": "doom_health_gathering_supreme"}, "metrics": [{"type": "mean_reward", "value": "9.56 +/- 4.15", "name": "mean_reward", "verified": false}]}]}]} | HusseinEid/rl_course_vizdoom_health_gathering_supreme | null | [
"sample-factory",
"tensorboard",
"deep-reinforcement-learning",
"reinforcement-learning",
"model-index",
"region:us"
] | null | 2024-04-28T22:02:46+00:00 | [] | [] | TAGS
#sample-factory #tensorboard #deep-reinforcement-learning #reinforcement-learning #model-index #region-us
|
A(n) APPO model trained on the doom_health_gathering_supreme environment.
This model was trained using Sample-Factory 2.0: URL
Documentation for how to use Sample-Factory can be found at URL
## Downloading the model
After installing Sample-Factory, download the model with:
## Using the model
To run the model after download, use the 'enjoy' script corresponding to this environment:
You can also upload models to the Hugging Face Hub using the same script with the '--push_to_hub' flag.
See URL for more details
## Training with this model
To continue training with this model, use the 'train' script corresponding to this environment:
Note, you may have to adjust '--train_for_env_steps' to a suitably high number as the experiment will resume at the number of steps it concluded at.
| [
"## Downloading the model\n\nAfter installing Sample-Factory, download the model with:",
"## Using the model\n\nTo run the model after download, use the 'enjoy' script corresponding to this environment:\n\n\n\nYou can also upload models to the Hugging Face Hub using the same script with the '--push_to_hub' flag.\nSee URL for more details",
"## Training with this model\n\nTo continue training with this model, use the 'train' script corresponding to this environment:\n\n\nNote, you may have to adjust '--train_for_env_steps' to a suitably high number as the experiment will resume at the number of steps it concluded at."
] | [
"TAGS\n#sample-factory #tensorboard #deep-reinforcement-learning #reinforcement-learning #model-index #region-us \n",
"## Downloading the model\n\nAfter installing Sample-Factory, download the model with:",
"## Using the model\n\nTo run the model after download, use the 'enjoy' script corresponding to this environment:\n\n\n\nYou can also upload models to the Hugging Face Hub using the same script with the '--push_to_hub' flag.\nSee URL for more details",
"## Training with this model\n\nTo continue training with this model, use the 'train' script corresponding to this environment:\n\n\nNote, you may have to adjust '--train_for_env_steps' to a suitably high number as the experiment will resume at the number of steps it concluded at."
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | shallow6414/e5x9rb2 | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T22:03:11+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-to-image | diffusers |
# SDXL LoRA DreamBooth - kzaleskaa/vector-graphics
<Gallery />
## Model description
These are kzaleskaa/vector-graphics LoRA adaption weights for stabilityai/stable-diffusion-xl-base-1.0.
The weights were trained using [DreamBooth](https://dreambooth.github.io/).
LoRA for the text encoder was enabled: False.
Special VAE used for training: None.
## Trigger words
You should use a woman in szn style to trigger the image generation.
## Download model
Weights for this model are available in Safetensors format.
[Download](kzaleskaa/vector-graphics/tree/main) them in the Files & versions tab.
| {"license": "openrail++", "tags": ["stable-diffusion-xl", "stable-diffusion-xl-diffusers", "text-to-image", "diffusers", "lora", "template:sd-lora"], "widget": [{"text": "a cat in szn style", "output": {"url": "image_0.png"}}, {"text": "a cat in szn style", "output": {"url": "image_1.png"}}, {"text": "a cat in szn style", "output": {"url": "image_2.png"}}, {"text": "a cat in szn style", "output": {"url": "image_3.png"}}], "base_model": "stabilityai/stable-diffusion-xl-base-1.0", "instance_prompt": "a woman in szn style"} | kzaleskaa/vector-graphics | null | [
"diffusers",
"stable-diffusion-xl",
"stable-diffusion-xl-diffusers",
"text-to-image",
"lora",
"template:sd-lora",
"base_model:stabilityai/stable-diffusion-xl-base-1.0",
"license:openrail++",
"region:us"
] | null | 2024-04-28T22:03:19+00:00 | [] | [] | TAGS
#diffusers #stable-diffusion-xl #stable-diffusion-xl-diffusers #text-to-image #lora #template-sd-lora #base_model-stabilityai/stable-diffusion-xl-base-1.0 #license-openrail++ #region-us
|
# SDXL LoRA DreamBooth - kzaleskaa/vector-graphics
<Gallery />
## Model description
These are kzaleskaa/vector-graphics LoRA adaption weights for stabilityai/stable-diffusion-xl-base-1.0.
The weights were trained using DreamBooth.
LoRA for the text encoder was enabled: False.
Special VAE used for training: None.
## Trigger words
You should use a woman in szn style to trigger the image generation.
## Download model
Weights for this model are available in Safetensors format.
Download them in the Files & versions tab.
| [
"# SDXL LoRA DreamBooth - kzaleskaa/vector-graphics\n\n<Gallery />",
"## Model description\n\nThese are kzaleskaa/vector-graphics LoRA adaption weights for stabilityai/stable-diffusion-xl-base-1.0.\n\nThe weights were trained using DreamBooth.\n\nLoRA for the text encoder was enabled: False.\n\nSpecial VAE used for training: None.",
"## Trigger words\n\nYou should use a woman in szn style to trigger the image generation.",
"## Download model\n\nWeights for this model are available in Safetensors format.\n\nDownload them in the Files & versions tab."
] | [
"TAGS\n#diffusers #stable-diffusion-xl #stable-diffusion-xl-diffusers #text-to-image #lora #template-sd-lora #base_model-stabilityai/stable-diffusion-xl-base-1.0 #license-openrail++ #region-us \n",
"# SDXL LoRA DreamBooth - kzaleskaa/vector-graphics\n\n<Gallery />",
"## Model description\n\nThese are kzaleskaa/vector-graphics LoRA adaption weights for stabilityai/stable-diffusion-xl-base-1.0.\n\nThe weights were trained using DreamBooth.\n\nLoRA for the text encoder was enabled: False.\n\nSpecial VAE used for training: None.",
"## Trigger words\n\nYou should use a woman in szn style to trigger the image generation.",
"## Download model\n\nWeights for this model are available in Safetensors format.\n\nDownload them in the Files & versions tab."
] |
null | null |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# G0428HMA22
This model is a fine-tuned version of [google/gemma-2b](https://huggingface.co/google/gemma-2b) on an unknown dataset.
It achieves the following results on the evaluation set:
- Loss: 0.1053
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 0.0003
- train_batch_size: 8
- eval_batch_size: 8
- seed: 42
- gradient_accumulation_steps: 16
- total_train_batch_size: 128
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: cosine_with_restarts
- lr_scheduler_warmup_steps: 80
- num_epochs: 3
- mixed_precision_training: Native AMP
### Training results
| Training Loss | Epoch | Step | Validation Loss |
|:-------------:|:-----:|:----:|:---------------:|
| 2.5672 | 0.09 | 10 | 1.5723 |
| 0.95 | 0.18 | 20 | 0.3053 |
| 0.1975 | 0.27 | 30 | 0.1617 |
| 0.1542 | 0.36 | 40 | 0.1482 |
| 0.1465 | 0.45 | 50 | 0.1487 |
| 0.148 | 0.54 | 60 | 0.1489 |
| 0.1482 | 0.63 | 70 | 0.1472 |
| 0.1491 | 0.73 | 80 | 0.1474 |
| 0.1423 | 0.82 | 90 | 0.1480 |
| 0.1448 | 0.91 | 100 | 0.1481 |
| 0.1481 | 1.0 | 110 | 0.1487 |
| 0.1439 | 1.09 | 120 | 0.1480 |
| 0.1453 | 1.18 | 130 | 0.1486 |
| 0.1463 | 1.27 | 140 | 0.1457 |
| 0.1462 | 1.36 | 150 | 0.1437 |
| 0.1372 | 1.45 | 160 | 0.1387 |
| 0.1398 | 1.54 | 170 | 0.1416 |
| 0.133 | 1.63 | 180 | 0.1324 |
| 0.1316 | 1.72 | 190 | 0.1315 |
| 0.1279 | 1.81 | 200 | 0.1283 |
| 0.1273 | 1.9 | 210 | 0.1243 |
| 0.1232 | 1.99 | 220 | 0.1185 |
| 0.1129 | 2.08 | 230 | 0.1186 |
| 0.1112 | 2.18 | 240 | 0.1143 |
| 0.1046 | 2.27 | 250 | 0.1138 |
| 0.1075 | 2.36 | 260 | 0.1122 |
| 0.1088 | 2.45 | 270 | 0.1098 |
| 0.1046 | 2.54 | 280 | 0.1102 |
| 0.0971 | 2.63 | 290 | 0.1084 |
| 0.0994 | 2.72 | 300 | 0.1072 |
| 0.1019 | 2.81 | 310 | 0.1058 |
| 0.1021 | 2.9 | 320 | 0.1054 |
| 0.1068 | 2.99 | 330 | 0.1053 |
### Framework versions
- Transformers 4.36.0.dev0
- Pytorch 2.1.2+cu121
- Datasets 2.14.6
- Tokenizers 0.14.1
| {"license": "gemma", "tags": ["generated_from_trainer"], "base_model": "google/gemma-2b", "model-index": [{"name": "G0428HMA22", "results": []}]} | Litzy619/G0428HMA22 | null | [
"safetensors",
"generated_from_trainer",
"base_model:google/gemma-2b",
"license:gemma",
"region:us"
] | null | 2024-04-28T22:04:33+00:00 | [] | [] | TAGS
#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us
| G0428HMA22
==========
This model is a fine-tuned version of google/gemma-2b on an unknown dataset.
It achieves the following results on the evaluation set:
* Loss: 0.1053
Model description
-----------------
More information needed
Intended uses & limitations
---------------------------
More information needed
Training and evaluation data
----------------------------
More information needed
Training procedure
------------------
### Training hyperparameters
The following hyperparameters were used during training:
* learning\_rate: 0.0003
* train\_batch\_size: 8
* eval\_batch\_size: 8
* seed: 42
* gradient\_accumulation\_steps: 16
* total\_train\_batch\_size: 128
* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
* lr\_scheduler\_type: cosine\_with\_restarts
* lr\_scheduler\_warmup\_steps: 80
* num\_epochs: 3
* mixed\_precision\_training: Native AMP
### Training results
### Framework versions
* Transformers 4.36.0.dev0
* Pytorch 2.1.2+cu121
* Datasets 2.14.6
* Tokenizers 0.14.1
| [
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 80\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] | [
"TAGS\n#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us \n",
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 80\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] |
token-classification | spacy | | Feature | Description |
| --- | --- |
| **Name** | `en_ner_sensitive_spacy` |
| **Version** | `0.0.0` |
| **spaCy** | `>=3.6.1,<3.7.0` |
| **Default Pipeline** | `tok2vec`, `ner` |
| **Components** | `tok2vec`, `ner` |
| **Vectors** | 514157 keys, 514157 unique vectors (300 dimensions) |
| **Sources** | n/a |
| **License** | n/a |
| **Author** | [n/a]() |
### Label Scheme
<details>
<summary>View label scheme (1 labels for 1 components)</summary>
| Component | Labels |
| --- | --- |
| **`ner`** | `APP` |
</details>
### Accuracy
| Type | Score |
| --- | --- |
| `ENTS_F` | 100.00 |
| `ENTS_P` | 100.00 |
| `ENTS_R` | 100.00 |
| `TOK2VEC_LOSS` | 0.00 |
| `NER_LOSS` | 0.00 | | {"language": ["en"], "tags": ["spacy", "token-classification"]} | MoinKhan3012/en_ner_sensitive_spacy | null | [
"spacy",
"token-classification",
"en",
"model-index",
"region:us"
] | null | 2024-04-28T22:04:52+00:00 | [] | [
"en"
] | TAGS
#spacy #token-classification #en #model-index #region-us
|
### Label Scheme
View label scheme (1 labels for 1 components)
### Accuracy
| [
"### Label Scheme\n\n\n\nView label scheme (1 labels for 1 components)",
"### Accuracy"
] | [
"TAGS\n#spacy #token-classification #en #model-index #region-us \n",
"### Label Scheme\n\n\n\nView label scheme (1 labels for 1 components)",
"### Accuracy"
] |
null | null |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# G0428HMA23
This model is a fine-tuned version of [google/gemma-2b](https://huggingface.co/google/gemma-2b) on an unknown dataset.
It achieves the following results on the evaluation set:
- Loss: 0.1053
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 0.0003
- train_batch_size: 8
- eval_batch_size: 8
- seed: 42
- gradient_accumulation_steps: 16
- total_train_batch_size: 128
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: cosine_with_restarts
- lr_scheduler_warmup_steps: 80
- num_epochs: 3
- mixed_precision_training: Native AMP
### Training results
| Training Loss | Epoch | Step | Validation Loss |
|:-------------:|:-----:|:----:|:---------------:|
| 2.5672 | 0.09 | 10 | 1.5723 |
| 0.95 | 0.18 | 20 | 0.3053 |
| 0.1975 | 0.27 | 30 | 0.1617 |
| 0.1542 | 0.36 | 40 | 0.1482 |
| 0.1465 | 0.45 | 50 | 0.1487 |
| 0.148 | 0.54 | 60 | 0.1489 |
| 0.1482 | 0.63 | 70 | 0.1472 |
| 0.1491 | 0.73 | 80 | 0.1474 |
| 0.1423 | 0.82 | 90 | 0.1480 |
| 0.1448 | 0.91 | 100 | 0.1481 |
| 0.1481 | 1.0 | 110 | 0.1487 |
| 0.1439 | 1.09 | 120 | 0.1480 |
| 0.1453 | 1.18 | 130 | 0.1486 |
| 0.1463 | 1.27 | 140 | 0.1457 |
| 0.1462 | 1.36 | 150 | 0.1437 |
| 0.1372 | 1.45 | 160 | 0.1387 |
| 0.1398 | 1.54 | 170 | 0.1416 |
| 0.133 | 1.63 | 180 | 0.1324 |
| 0.1316 | 1.72 | 190 | 0.1315 |
| 0.1279 | 1.81 | 200 | 0.1283 |
| 0.1273 | 1.9 | 210 | 0.1243 |
| 0.1232 | 1.99 | 220 | 0.1185 |
| 0.1129 | 2.08 | 230 | 0.1186 |
| 0.1112 | 2.18 | 240 | 0.1143 |
| 0.1046 | 2.27 | 250 | 0.1138 |
| 0.1075 | 2.36 | 260 | 0.1122 |
| 0.1088 | 2.45 | 270 | 0.1098 |
| 0.1046 | 2.54 | 280 | 0.1102 |
| 0.0971 | 2.63 | 290 | 0.1084 |
| 0.0994 | 2.72 | 300 | 0.1072 |
| 0.1019 | 2.81 | 310 | 0.1058 |
| 0.1021 | 2.9 | 320 | 0.1054 |
| 0.1068 | 2.99 | 330 | 0.1053 |
### Framework versions
- Transformers 4.36.0.dev0
- Pytorch 2.1.2+cu121
- Datasets 2.14.6
- Tokenizers 0.14.1
| {"license": "gemma", "tags": ["generated_from_trainer"], "base_model": "google/gemma-2b", "model-index": [{"name": "G0428HMA23", "results": []}]} | Litzy619/G0428HMA23 | null | [
"safetensors",
"generated_from_trainer",
"base_model:google/gemma-2b",
"license:gemma",
"region:us"
] | null | 2024-04-28T22:05:36+00:00 | [] | [] | TAGS
#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us
| G0428HMA23
==========
This model is a fine-tuned version of google/gemma-2b on an unknown dataset.
It achieves the following results on the evaluation set:
* Loss: 0.1053
Model description
-----------------
More information needed
Intended uses & limitations
---------------------------
More information needed
Training and evaluation data
----------------------------
More information needed
Training procedure
------------------
### Training hyperparameters
The following hyperparameters were used during training:
* learning\_rate: 0.0003
* train\_batch\_size: 8
* eval\_batch\_size: 8
* seed: 42
* gradient\_accumulation\_steps: 16
* total\_train\_batch\_size: 128
* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
* lr\_scheduler\_type: cosine\_with\_restarts
* lr\_scheduler\_warmup\_steps: 80
* num\_epochs: 3
* mixed\_precision\_training: Native AMP
### Training results
### Framework versions
* Transformers 4.36.0.dev0
* Pytorch 2.1.2+cu121
* Datasets 2.14.6
* Tokenizers 0.14.1
| [
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 80\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] | [
"TAGS\n#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us \n",
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 80\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] |
null | null |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# G0428HMA26
This model is a fine-tuned version of [google/gemma-2b](https://huggingface.co/google/gemma-2b) on an unknown dataset.
It achieves the following results on the evaluation set:
- Loss: 0.1123
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 0.0003
- train_batch_size: 8
- eval_batch_size: 8
- seed: 42
- gradient_accumulation_steps: 16
- total_train_batch_size: 128
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: cosine_with_restarts
- lr_scheduler_warmup_steps: 80
- num_epochs: 3
- mixed_precision_training: Native AMP
### Training results
| Training Loss | Epoch | Step | Validation Loss |
|:-------------:|:-----:|:----:|:---------------:|
| 2.48 | 0.09 | 10 | 1.3998 |
| 0.7559 | 0.18 | 20 | 0.2139 |
| 0.1722 | 0.27 | 30 | 0.1588 |
| 0.1516 | 0.36 | 40 | 0.1510 |
| 0.1466 | 0.45 | 50 | 0.1478 |
| 0.1473 | 0.54 | 60 | 0.1488 |
| 0.148 | 0.63 | 70 | 0.1479 |
| 0.1505 | 0.73 | 80 | 0.1491 |
| 0.1423 | 0.82 | 90 | 0.1494 |
| 0.1466 | 0.91 | 100 | 0.1490 |
| 0.1486 | 1.0 | 110 | 0.1487 |
| 0.1603 | 1.09 | 120 | 0.1975 |
| 0.298 | 1.18 | 130 | 0.6268 |
| 0.362 | 1.27 | 140 | 0.1486 |
| 0.1493 | 1.36 | 150 | 0.1485 |
| 0.1402 | 1.45 | 160 | 0.1469 |
| 0.1442 | 1.54 | 170 | 0.1431 |
| 0.1346 | 1.63 | 180 | 0.1396 |
| 0.1405 | 1.72 | 190 | 0.1378 |
| 0.132 | 1.81 | 200 | 0.1358 |
| 0.1309 | 1.9 | 210 | 0.1311 |
| 0.1266 | 1.99 | 220 | 0.1243 |
| 0.119 | 2.08 | 230 | 0.1219 |
| 0.1183 | 2.18 | 240 | 0.1208 |
| 0.114 | 2.27 | 250 | 0.1188 |
| 0.1129 | 2.36 | 260 | 0.1212 |
| 0.1152 | 2.45 | 270 | 0.1179 |
| 0.105 | 2.54 | 280 | 0.1157 |
| 0.106 | 2.63 | 290 | 0.1125 |
| 0.1033 | 2.72 | 300 | 0.1127 |
| 0.1074 | 2.81 | 310 | 0.1123 |
| 0.1098 | 2.9 | 320 | 0.1123 |
| 0.1091 | 2.99 | 330 | 0.1123 |
### Framework versions
- Transformers 4.36.0.dev0
- Pytorch 2.1.2+cu121
- Datasets 2.14.6
- Tokenizers 0.14.1
| {"license": "gemma", "tags": ["generated_from_trainer"], "base_model": "google/gemma-2b", "model-index": [{"name": "G0428HMA26", "results": []}]} | Litzy619/G0428HMA26 | null | [
"safetensors",
"generated_from_trainer",
"base_model:google/gemma-2b",
"license:gemma",
"region:us"
] | null | 2024-04-28T22:06:15+00:00 | [] | [] | TAGS
#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us
| G0428HMA26
==========
This model is a fine-tuned version of google/gemma-2b on an unknown dataset.
It achieves the following results on the evaluation set:
* Loss: 0.1123
Model description
-----------------
More information needed
Intended uses & limitations
---------------------------
More information needed
Training and evaluation data
----------------------------
More information needed
Training procedure
------------------
### Training hyperparameters
The following hyperparameters were used during training:
* learning\_rate: 0.0003
* train\_batch\_size: 8
* eval\_batch\_size: 8
* seed: 42
* gradient\_accumulation\_steps: 16
* total\_train\_batch\_size: 128
* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
* lr\_scheduler\_type: cosine\_with\_restarts
* lr\_scheduler\_warmup\_steps: 80
* num\_epochs: 3
* mixed\_precision\_training: Native AMP
### Training results
### Framework versions
* Transformers 4.36.0.dev0
* Pytorch 2.1.2+cu121
* Datasets 2.14.6
* Tokenizers 0.14.1
| [
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 80\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] | [
"TAGS\n#safetensors #generated_from_trainer #base_model-google/gemma-2b #license-gemma #region-us \n",
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 0.0003\n* train\\_batch\\_size: 8\n* eval\\_batch\\_size: 8\n* seed: 42\n* gradient\\_accumulation\\_steps: 16\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: cosine\\_with\\_restarts\n* lr\\_scheduler\\_warmup\\_steps: 80\n* num\\_epochs: 3\n* mixed\\_precision\\_training: Native AMP",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.36.0.dev0\n* Pytorch 2.1.2+cu121\n* Datasets 2.14.6\n* Tokenizers 0.14.1"
] |
text-generation | transformers | Quantization made by Richard Erkhov.
[Github](https://github.com/RichardErkhov)
[Discord](https://discord.gg/pvy7H8DZMG)
[Request more models](https://github.com/RichardErkhov/quant_request)
galactica-125m - bnb 4bits
- Model creator: https://huggingface.co/facebook/
- Original model: https://huggingface.co/facebook/galactica-125m/
Original model description:
---
license: cc-by-nc-4.0
tags:
- galactica
widget:
- text: "The Transformer architecture [START_REF]"
- text: "The Schwarzschild radius is defined as: \\["
- text: "A force of 0.6N is applied to an object, which accelerates at 3m/s. What is its mass? <work>"
- text: "Lecture 1: The Ising Model\n\n"
- text: "[START_I_SMILES]"
- text: "[START_AMINO]GHMQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP[END_AMINO] ## Keywords"
inference: false
---

# GALACTICA 125M (mini)
Model card from the original [repo](https://github.com/paperswithcode/galai/blob/main/docs/model_card.md)
Following [Mitchell et al. (2018)](https://arxiv.org/abs/1810.03993), this model card provides information about the GALACTICA model, how it was trained, and the intended use cases. Full details about how the model was trained and evaluated can be found in the [release paper](https://galactica.org/paper.pdf).
## Model Details
The GALACTICA models are trained on a large-scale scientific corpus. The models are designed to perform scientific tasks, including but not limited to citation prediction, scientific QA, mathematical reasoning, summarization, document generation, molecular property prediction and entity extraction. The models were developed by the Papers with Code team at Meta AI to study the use of language models for the automatic organization of science. We train models with sizes ranging from 125M to 120B parameters. Below is a summary of the released models:
| Size | Parameters |
|:-----------:|:-----------:|
| `mini` | 125 M |
| `base` | 1.3 B |
| `standard` | 6.7 B |
| `large` | 30 B |
| `huge` | 120 B |
## Release Date
November 2022
## Model Type
Transformer based architecture in a decoder-only setup with a few modifications (see paper for more details).
## Paper & Demo
[Paper](https://galactica.org/paper.pdf) / [Demo](https://galactica.org)
## Model Use
The primary intended users of the GALACTICA models are researchers studying language models applied to the scientific domain. We also anticipate the model will be useful for developers who wish to build scientific tooling. However, we caution against production use without safeguards given the potential of language models to hallucinate.
The models are made available under a non-commercial CC BY-NC 4.0 license. More information about how to use the model can be found in the README.md of this repository.
## Training Data
The GALACTICA models are trained on 106 billion tokens of open-access scientific text and data. This includes papers, textbooks, scientific websites, encyclopedias, reference material, knowledge bases, and more. We tokenize different modalities to provide a natural langauge interface for different tasks. See the README.md for more information. See the paper for full information on the training data.
## How to use
Find below some example scripts on how to use the model in `transformers`:
## Using the Pytorch model
### Running the model on a CPU
<details>
<summary> Click to expand </summary>
```python
from transformers import AutoTokenizer, OPTForCausalLM
tokenizer = AutoTokenizer.from_pretrained("facebook/galactica-125m")
model = OPTForCausalLM.from_pretrained("facebook/galactica-125m")
input_text = "The Transformer architecture [START_REF]"
input_ids = tokenizer(input_text, return_tensors="pt").input_ids
outputs = model.generate(input_ids)
print(tokenizer.decode(outputs[0]))
```
</details>
### Running the model on a GPU
<details>
<summary> Click to expand </summary>
```python
# pip install accelerate
from transformers import AutoTokenizer, OPTForCausalLM
tokenizer = AutoTokenizer.from_pretrained("facebook/galactica-125m")
model = OPTForCausalLM.from_pretrained("facebook/galactica-125m", device_map="auto")
input_text = "The Transformer architecture [START_REF]"
input_ids = tokenizer(input_text, return_tensors="pt").input_ids.to("cuda")
outputs = model.generate(input_ids)
print(tokenizer.decode(outputs[0]))
```
</details>
### Running the model on a GPU using different precisions
#### FP16
<details>
<summary> Click to expand </summary>
```python
# pip install accelerate
import torch
from transformers import AutoTokenizer, OPTForCausalLM
tokenizer = AutoTokenizer.from_pretrained("facebook/galactica-125m")
model = OPTForCausalLM.from_pretrained("facebook/galactica-125m", device_map="auto", torch_dtype=torch.float16)
input_text = "The Transformer architecture [START_REF]"
input_ids = tokenizer(input_text, return_tensors="pt").input_ids.to("cuda")
outputs = model.generate(input_ids)
print(tokenizer.decode(outputs[0]))
```
</details>
#### INT8
<details>
<summary> Click to expand </summary>
```python
# pip install bitsandbytes accelerate
from transformers import AutoTokenizer, OPTForCausalLM
tokenizer = AutoTokenizer.from_pretrained("facebook/galactica-125m")
model = OPTForCausalLM.from_pretrained("facebook/galactica-125m", device_map="auto", load_in_8bit=True)
input_text = "The Transformer architecture [START_REF]"
input_ids = tokenizer(input_text, return_tensors="pt").input_ids.to("cuda")
outputs = model.generate(input_ids)
print(tokenizer.decode(outputs[0]))
```
</details>
## Performance and Limitations
The model outperforms several existing language models on a range of knowledge probes, reasoning, and knowledge-intensive scientific tasks. This also extends to general NLP tasks, where GALACTICA outperforms other open source general language models. That being said, we note a number of limitations in this section.
As with other language models, GALACTICA is often prone to hallucination - and training on a high-quality academic corpus does not prevent this, especially for less popular and less cited scientific concepts. There are no guarantees of truthful output when generating from the model. This extends to specific modalities such as citation prediction. While GALACTICA's citation behaviour approaches the ground truth citation behaviour with scale, the model continues to exhibit a popularity bias at larger scales.
In addition, we evaluated the model on several types of benchmarks related to stereotypes and toxicity. Overall, the model exhibits substantially lower toxicity rates compared to other large language models. That being said, the model continues to exhibit bias on certain measures (see the paper for details). So we recommend care when using the model for generations.
## Broader Implications
GALACTICA can potentially be used as a new way to discover academic literature. We also expect a lot of downstream use for application to particular domains, such as mathematics, biology, and chemistry. In the paper, we demonstrated several examples of the model acting as alternative to standard search tools. We expect a new generation of scientific tools to be built upon large language models such as GALACTICA.
We encourage researchers to investigate beneficial and new use cases for these models. That being said, it is important to be aware of the current limitations of large language models. Researchers should pay attention to common issues such as hallucination and biases that could emerge from using these models.
## Citation
```bibtex
@inproceedings{GALACTICA,
title={GALACTICA: A Large Language Model for Science},
author={Ross Taylor and Marcin Kardas and Guillem Cucurull and Thomas Scialom and Anthony Hartshorn and Elvis Saravia and Andrew Poulton and Viktor Kerkez and Robert Stojnic},
year={2022}
}
```
| {} | RichardErkhov/facebook_-_galactica-125m-4bits | null | [
"transformers",
"safetensors",
"opt",
"text-generation",
"arxiv:1810.03993",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"4-bit",
"region:us"
] | null | 2024-04-28T22:06:57+00:00 | [
"1810.03993"
] | [] | TAGS
#transformers #safetensors #opt #text-generation #arxiv-1810.03993 #autotrain_compatible #endpoints_compatible #text-generation-inference #4-bit #region-us
| Quantization made by Richard Erkhov.
Github
Discord
Request more models
galactica-125m - bnb 4bits
* Model creator: URL
* Original model: URL
Original model description:
---------------------------
license: cc-by-nc-4.0
tags:
* galactica
widget:
* text: "The Transformer architecture [START\_REF]"
* text: "The Schwarzschild radius is defined as: \["
* text: "A force of 0.6N is applied to an object, which accelerates at 3m/s. What is its mass? "
* text: "Lecture 1: The Ising Model\n\n"
* text: "[START\_I\_SMILES]"
* text: "[START\_AMINO]GHMQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP[END\_AMINO] ## Keywords"
inference: false
---
!logo
GALACTICA 125M (mini)
=====================
Model card from the original repo
Following Mitchell et al. (2018), this model card provides information about the GALACTICA model, how it was trained, and the intended use cases. Full details about how the model was trained and evaluated can be found in the release paper.
Model Details
-------------
The GALACTICA models are trained on a large-scale scientific corpus. The models are designed to perform scientific tasks, including but not limited to citation prediction, scientific QA, mathematical reasoning, summarization, document generation, molecular property prediction and entity extraction. The models were developed by the Papers with Code team at Meta AI to study the use of language models for the automatic organization of science. We train models with sizes ranging from 125M to 120B parameters. Below is a summary of the released models:
Release Date
------------
November 2022
Model Type
----------
Transformer based architecture in a decoder-only setup with a few modifications (see paper for more details).
Paper & Demo
------------
Paper / Demo
Model Use
---------
The primary intended users of the GALACTICA models are researchers studying language models applied to the scientific domain. We also anticipate the model will be useful for developers who wish to build scientific tooling. However, we caution against production use without safeguards given the potential of language models to hallucinate.
The models are made available under a non-commercial CC BY-NC 4.0 license. More information about how to use the model can be found in the URL of this repository.
Training Data
-------------
The GALACTICA models are trained on 106 billion tokens of open-access scientific text and data. This includes papers, textbooks, scientific websites, encyclopedias, reference material, knowledge bases, and more. We tokenize different modalities to provide a natural langauge interface for different tasks. See the URL for more information. See the paper for full information on the training data.
How to use
----------
Find below some example scripts on how to use the model in 'transformers':
Using the Pytorch model
-----------------------
### Running the model on a CPU
Click to expand
### Running the model on a GPU
Click to expand
### Running the model on a GPU using different precisions
#### FP16
Click to expand
#### INT8
Click to expand
Performance and Limitations
---------------------------
The model outperforms several existing language models on a range of knowledge probes, reasoning, and knowledge-intensive scientific tasks. This also extends to general NLP tasks, where GALACTICA outperforms other open source general language models. That being said, we note a number of limitations in this section.
As with other language models, GALACTICA is often prone to hallucination - and training on a high-quality academic corpus does not prevent this, especially for less popular and less cited scientific concepts. There are no guarantees of truthful output when generating from the model. This extends to specific modalities such as citation prediction. While GALACTICA's citation behaviour approaches the ground truth citation behaviour with scale, the model continues to exhibit a popularity bias at larger scales.
In addition, we evaluated the model on several types of benchmarks related to stereotypes and toxicity. Overall, the model exhibits substantially lower toxicity rates compared to other large language models. That being said, the model continues to exhibit bias on certain measures (see the paper for details). So we recommend care when using the model for generations.
Broader Implications
--------------------
GALACTICA can potentially be used as a new way to discover academic literature. We also expect a lot of downstream use for application to particular domains, such as mathematics, biology, and chemistry. In the paper, we demonstrated several examples of the model acting as alternative to standard search tools. We expect a new generation of scientific tools to be built upon large language models such as GALACTICA.
We encourage researchers to investigate beneficial and new use cases for these models. That being said, it is important to be aware of the current limitations of large language models. Researchers should pay attention to common issues such as hallucination and biases that could emerge from using these models.
| [
"## Keywords\"\ninference: false\n\n\n\n\n---\n\n\n!logo\n\n\nGALACTICA 125M (mini)\n=====================\n\n\nModel card from the original repo\n\n\nFollowing Mitchell et al. (2018), this model card provides information about the GALACTICA model, how it was trained, and the intended use cases. Full details about how the model was trained and evaluated can be found in the release paper.\n\n\nModel Details\n-------------\n\n\nThe GALACTICA models are trained on a large-scale scientific corpus. The models are designed to perform scientific tasks, including but not limited to citation prediction, scientific QA, mathematical reasoning, summarization, document generation, molecular property prediction and entity extraction. The models were developed by the Papers with Code team at Meta AI to study the use of language models for the automatic organization of science. We train models with sizes ranging from 125M to 120B parameters. Below is a summary of the released models:\n\n\n\nRelease Date\n------------\n\n\nNovember 2022\n\n\nModel Type\n----------\n\n\nTransformer based architecture in a decoder-only setup with a few modifications (see paper for more details).\n\n\nPaper & Demo\n------------\n\n\nPaper / Demo\n\n\nModel Use\n---------\n\n\nThe primary intended users of the GALACTICA models are researchers studying language models applied to the scientific domain. We also anticipate the model will be useful for developers who wish to build scientific tooling. However, we caution against production use without safeguards given the potential of language models to hallucinate.\n\n\nThe models are made available under a non-commercial CC BY-NC 4.0 license. More information about how to use the model can be found in the URL of this repository.\n\n\nTraining Data\n-------------\n\n\nThe GALACTICA models are trained on 106 billion tokens of open-access scientific text and data. This includes papers, textbooks, scientific websites, encyclopedias, reference material, knowledge bases, and more. We tokenize different modalities to provide a natural langauge interface for different tasks. See the URL for more information. See the paper for full information on the training data.\n\n\nHow to use\n----------\n\n\nFind below some example scripts on how to use the model in 'transformers':\n\n\nUsing the Pytorch model\n-----------------------",
"### Running the model on a CPU\n\n\n\n Click to expand",
"### Running the model on a GPU\n\n\n\n Click to expand",
"### Running the model on a GPU using different precisions",
"#### FP16\n\n\n\n Click to expand",
"#### INT8\n\n\n\n Click to expand \n\nPerformance and Limitations\n---------------------------\n\n\nThe model outperforms several existing language models on a range of knowledge probes, reasoning, and knowledge-intensive scientific tasks. This also extends to general NLP tasks, where GALACTICA outperforms other open source general language models. That being said, we note a number of limitations in this section.\n\n\nAs with other language models, GALACTICA is often prone to hallucination - and training on a high-quality academic corpus does not prevent this, especially for less popular and less cited scientific concepts. There are no guarantees of truthful output when generating from the model. This extends to specific modalities such as citation prediction. While GALACTICA's citation behaviour approaches the ground truth citation behaviour with scale, the model continues to exhibit a popularity bias at larger scales.\n\n\nIn addition, we evaluated the model on several types of benchmarks related to stereotypes and toxicity. Overall, the model exhibits substantially lower toxicity rates compared to other large language models. That being said, the model continues to exhibit bias on certain measures (see the paper for details). So we recommend care when using the model for generations.\n\n\nBroader Implications\n--------------------\n\n\nGALACTICA can potentially be used as a new way to discover academic literature. We also expect a lot of downstream use for application to particular domains, such as mathematics, biology, and chemistry. In the paper, we demonstrated several examples of the model acting as alternative to standard search tools. We expect a new generation of scientific tools to be built upon large language models such as GALACTICA.\n\n\nWe encourage researchers to investigate beneficial and new use cases for these models. That being said, it is important to be aware of the current limitations of large language models. Researchers should pay attention to common issues such as hallucination and biases that could emerge from using these models."
] | [
"TAGS\n#transformers #safetensors #opt #text-generation #arxiv-1810.03993 #autotrain_compatible #endpoints_compatible #text-generation-inference #4-bit #region-us \n",
"## Keywords\"\ninference: false\n\n\n\n\n---\n\n\n!logo\n\n\nGALACTICA 125M (mini)\n=====================\n\n\nModel card from the original repo\n\n\nFollowing Mitchell et al. (2018), this model card provides information about the GALACTICA model, how it was trained, and the intended use cases. Full details about how the model was trained and evaluated can be found in the release paper.\n\n\nModel Details\n-------------\n\n\nThe GALACTICA models are trained on a large-scale scientific corpus. The models are designed to perform scientific tasks, including but not limited to citation prediction, scientific QA, mathematical reasoning, summarization, document generation, molecular property prediction and entity extraction. The models were developed by the Papers with Code team at Meta AI to study the use of language models for the automatic organization of science. We train models with sizes ranging from 125M to 120B parameters. Below is a summary of the released models:\n\n\n\nRelease Date\n------------\n\n\nNovember 2022\n\n\nModel Type\n----------\n\n\nTransformer based architecture in a decoder-only setup with a few modifications (see paper for more details).\n\n\nPaper & Demo\n------------\n\n\nPaper / Demo\n\n\nModel Use\n---------\n\n\nThe primary intended users of the GALACTICA models are researchers studying language models applied to the scientific domain. We also anticipate the model will be useful for developers who wish to build scientific tooling. However, we caution against production use without safeguards given the potential of language models to hallucinate.\n\n\nThe models are made available under a non-commercial CC BY-NC 4.0 license. More information about how to use the model can be found in the URL of this repository.\n\n\nTraining Data\n-------------\n\n\nThe GALACTICA models are trained on 106 billion tokens of open-access scientific text and data. This includes papers, textbooks, scientific websites, encyclopedias, reference material, knowledge bases, and more. We tokenize different modalities to provide a natural langauge interface for different tasks. See the URL for more information. See the paper for full information on the training data.\n\n\nHow to use\n----------\n\n\nFind below some example scripts on how to use the model in 'transformers':\n\n\nUsing the Pytorch model\n-----------------------",
"### Running the model on a CPU\n\n\n\n Click to expand",
"### Running the model on a GPU\n\n\n\n Click to expand",
"### Running the model on a GPU using different precisions",
"#### FP16\n\n\n\n Click to expand",
"#### INT8\n\n\n\n Click to expand \n\nPerformance and Limitations\n---------------------------\n\n\nThe model outperforms several existing language models on a range of knowledge probes, reasoning, and knowledge-intensive scientific tasks. This also extends to general NLP tasks, where GALACTICA outperforms other open source general language models. That being said, we note a number of limitations in this section.\n\n\nAs with other language models, GALACTICA is often prone to hallucination - and training on a high-quality academic corpus does not prevent this, especially for less popular and less cited scientific concepts. There are no guarantees of truthful output when generating from the model. This extends to specific modalities such as citation prediction. While GALACTICA's citation behaviour approaches the ground truth citation behaviour with scale, the model continues to exhibit a popularity bias at larger scales.\n\n\nIn addition, we evaluated the model on several types of benchmarks related to stereotypes and toxicity. Overall, the model exhibits substantially lower toxicity rates compared to other large language models. That being said, the model continues to exhibit bias on certain measures (see the paper for details). So we recommend care when using the model for generations.\n\n\nBroader Implications\n--------------------\n\n\nGALACTICA can potentially be used as a new way to discover academic literature. We also expect a lot of downstream use for application to particular domains, such as mathematics, biology, and chemistry. In the paper, we demonstrated several examples of the model acting as alternative to standard search tools. We expect a new generation of scientific tools to be built upon large language models such as GALACTICA.\n\n\nWe encourage researchers to investigate beneficial and new use cases for these models. That being said, it is important to be aware of the current limitations of large language models. Researchers should pay attention to common issues such as hallucination and biases that could emerge from using these models."
] |
text-generation | transformers | Quantization made by Richard Erkhov.
[Github](https://github.com/RichardErkhov)
[Discord](https://discord.gg/pvy7H8DZMG)
[Request more models](https://github.com/RichardErkhov/quant_request)
galactica-125m - bnb 8bits
- Model creator: https://huggingface.co/facebook/
- Original model: https://huggingface.co/facebook/galactica-125m/
Original model description:
---
license: cc-by-nc-4.0
tags:
- galactica
widget:
- text: "The Transformer architecture [START_REF]"
- text: "The Schwarzschild radius is defined as: \\["
- text: "A force of 0.6N is applied to an object, which accelerates at 3m/s. What is its mass? <work>"
- text: "Lecture 1: The Ising Model\n\n"
- text: "[START_I_SMILES]"
- text: "[START_AMINO]GHMQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP[END_AMINO] ## Keywords"
inference: false
---

# GALACTICA 125M (mini)
Model card from the original [repo](https://github.com/paperswithcode/galai/blob/main/docs/model_card.md)
Following [Mitchell et al. (2018)](https://arxiv.org/abs/1810.03993), this model card provides information about the GALACTICA model, how it was trained, and the intended use cases. Full details about how the model was trained and evaluated can be found in the [release paper](https://galactica.org/paper.pdf).
## Model Details
The GALACTICA models are trained on a large-scale scientific corpus. The models are designed to perform scientific tasks, including but not limited to citation prediction, scientific QA, mathematical reasoning, summarization, document generation, molecular property prediction and entity extraction. The models were developed by the Papers with Code team at Meta AI to study the use of language models for the automatic organization of science. We train models with sizes ranging from 125M to 120B parameters. Below is a summary of the released models:
| Size | Parameters |
|:-----------:|:-----------:|
| `mini` | 125 M |
| `base` | 1.3 B |
| `standard` | 6.7 B |
| `large` | 30 B |
| `huge` | 120 B |
## Release Date
November 2022
## Model Type
Transformer based architecture in a decoder-only setup with a few modifications (see paper for more details).
## Paper & Demo
[Paper](https://galactica.org/paper.pdf) / [Demo](https://galactica.org)
## Model Use
The primary intended users of the GALACTICA models are researchers studying language models applied to the scientific domain. We also anticipate the model will be useful for developers who wish to build scientific tooling. However, we caution against production use without safeguards given the potential of language models to hallucinate.
The models are made available under a non-commercial CC BY-NC 4.0 license. More information about how to use the model can be found in the README.md of this repository.
## Training Data
The GALACTICA models are trained on 106 billion tokens of open-access scientific text and data. This includes papers, textbooks, scientific websites, encyclopedias, reference material, knowledge bases, and more. We tokenize different modalities to provide a natural langauge interface for different tasks. See the README.md for more information. See the paper for full information on the training data.
## How to use
Find below some example scripts on how to use the model in `transformers`:
## Using the Pytorch model
### Running the model on a CPU
<details>
<summary> Click to expand </summary>
```python
from transformers import AutoTokenizer, OPTForCausalLM
tokenizer = AutoTokenizer.from_pretrained("facebook/galactica-125m")
model = OPTForCausalLM.from_pretrained("facebook/galactica-125m")
input_text = "The Transformer architecture [START_REF]"
input_ids = tokenizer(input_text, return_tensors="pt").input_ids
outputs = model.generate(input_ids)
print(tokenizer.decode(outputs[0]))
```
</details>
### Running the model on a GPU
<details>
<summary> Click to expand </summary>
```python
# pip install accelerate
from transformers import AutoTokenizer, OPTForCausalLM
tokenizer = AutoTokenizer.from_pretrained("facebook/galactica-125m")
model = OPTForCausalLM.from_pretrained("facebook/galactica-125m", device_map="auto")
input_text = "The Transformer architecture [START_REF]"
input_ids = tokenizer(input_text, return_tensors="pt").input_ids.to("cuda")
outputs = model.generate(input_ids)
print(tokenizer.decode(outputs[0]))
```
</details>
### Running the model on a GPU using different precisions
#### FP16
<details>
<summary> Click to expand </summary>
```python
# pip install accelerate
import torch
from transformers import AutoTokenizer, OPTForCausalLM
tokenizer = AutoTokenizer.from_pretrained("facebook/galactica-125m")
model = OPTForCausalLM.from_pretrained("facebook/galactica-125m", device_map="auto", torch_dtype=torch.float16)
input_text = "The Transformer architecture [START_REF]"
input_ids = tokenizer(input_text, return_tensors="pt").input_ids.to("cuda")
outputs = model.generate(input_ids)
print(tokenizer.decode(outputs[0]))
```
</details>
#### INT8
<details>
<summary> Click to expand </summary>
```python
# pip install bitsandbytes accelerate
from transformers import AutoTokenizer, OPTForCausalLM
tokenizer = AutoTokenizer.from_pretrained("facebook/galactica-125m")
model = OPTForCausalLM.from_pretrained("facebook/galactica-125m", device_map="auto", load_in_8bit=True)
input_text = "The Transformer architecture [START_REF]"
input_ids = tokenizer(input_text, return_tensors="pt").input_ids.to("cuda")
outputs = model.generate(input_ids)
print(tokenizer.decode(outputs[0]))
```
</details>
## Performance and Limitations
The model outperforms several existing language models on a range of knowledge probes, reasoning, and knowledge-intensive scientific tasks. This also extends to general NLP tasks, where GALACTICA outperforms other open source general language models. That being said, we note a number of limitations in this section.
As with other language models, GALACTICA is often prone to hallucination - and training on a high-quality academic corpus does not prevent this, especially for less popular and less cited scientific concepts. There are no guarantees of truthful output when generating from the model. This extends to specific modalities such as citation prediction. While GALACTICA's citation behaviour approaches the ground truth citation behaviour with scale, the model continues to exhibit a popularity bias at larger scales.
In addition, we evaluated the model on several types of benchmarks related to stereotypes and toxicity. Overall, the model exhibits substantially lower toxicity rates compared to other large language models. That being said, the model continues to exhibit bias on certain measures (see the paper for details). So we recommend care when using the model for generations.
## Broader Implications
GALACTICA can potentially be used as a new way to discover academic literature. We also expect a lot of downstream use for application to particular domains, such as mathematics, biology, and chemistry. In the paper, we demonstrated several examples of the model acting as alternative to standard search tools. We expect a new generation of scientific tools to be built upon large language models such as GALACTICA.
We encourage researchers to investigate beneficial and new use cases for these models. That being said, it is important to be aware of the current limitations of large language models. Researchers should pay attention to common issues such as hallucination and biases that could emerge from using these models.
## Citation
```bibtex
@inproceedings{GALACTICA,
title={GALACTICA: A Large Language Model for Science},
author={Ross Taylor and Marcin Kardas and Guillem Cucurull and Thomas Scialom and Anthony Hartshorn and Elvis Saravia and Andrew Poulton and Viktor Kerkez and Robert Stojnic},
year={2022}
}
```
| {} | RichardErkhov/facebook_-_galactica-125m-8bits | null | [
"transformers",
"safetensors",
"opt",
"text-generation",
"arxiv:1810.03993",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"8-bit",
"region:us"
] | null | 2024-04-28T22:07:18+00:00 | [
"1810.03993"
] | [] | TAGS
#transformers #safetensors #opt #text-generation #arxiv-1810.03993 #autotrain_compatible #endpoints_compatible #text-generation-inference #8-bit #region-us
| Quantization made by Richard Erkhov.
Github
Discord
Request more models
galactica-125m - bnb 8bits
* Model creator: URL
* Original model: URL
Original model description:
---------------------------
license: cc-by-nc-4.0
tags:
* galactica
widget:
* text: "The Transformer architecture [START\_REF]"
* text: "The Schwarzschild radius is defined as: \["
* text: "A force of 0.6N is applied to an object, which accelerates at 3m/s. What is its mass? "
* text: "Lecture 1: The Ising Model\n\n"
* text: "[START\_I\_SMILES]"
* text: "[START\_AMINO]GHMQSITAGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGAKFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELP[END\_AMINO] ## Keywords"
inference: false
---
!logo
GALACTICA 125M (mini)
=====================
Model card from the original repo
Following Mitchell et al. (2018), this model card provides information about the GALACTICA model, how it was trained, and the intended use cases. Full details about how the model was trained and evaluated can be found in the release paper.
Model Details
-------------
The GALACTICA models are trained on a large-scale scientific corpus. The models are designed to perform scientific tasks, including but not limited to citation prediction, scientific QA, mathematical reasoning, summarization, document generation, molecular property prediction and entity extraction. The models were developed by the Papers with Code team at Meta AI to study the use of language models for the automatic organization of science. We train models with sizes ranging from 125M to 120B parameters. Below is a summary of the released models:
Release Date
------------
November 2022
Model Type
----------
Transformer based architecture in a decoder-only setup with a few modifications (see paper for more details).
Paper & Demo
------------
Paper / Demo
Model Use
---------
The primary intended users of the GALACTICA models are researchers studying language models applied to the scientific domain. We also anticipate the model will be useful for developers who wish to build scientific tooling. However, we caution against production use without safeguards given the potential of language models to hallucinate.
The models are made available under a non-commercial CC BY-NC 4.0 license. More information about how to use the model can be found in the URL of this repository.
Training Data
-------------
The GALACTICA models are trained on 106 billion tokens of open-access scientific text and data. This includes papers, textbooks, scientific websites, encyclopedias, reference material, knowledge bases, and more. We tokenize different modalities to provide a natural langauge interface for different tasks. See the URL for more information. See the paper for full information on the training data.
How to use
----------
Find below some example scripts on how to use the model in 'transformers':
Using the Pytorch model
-----------------------
### Running the model on a CPU
Click to expand
### Running the model on a GPU
Click to expand
### Running the model on a GPU using different precisions
#### FP16
Click to expand
#### INT8
Click to expand
Performance and Limitations
---------------------------
The model outperforms several existing language models on a range of knowledge probes, reasoning, and knowledge-intensive scientific tasks. This also extends to general NLP tasks, where GALACTICA outperforms other open source general language models. That being said, we note a number of limitations in this section.
As with other language models, GALACTICA is often prone to hallucination - and training on a high-quality academic corpus does not prevent this, especially for less popular and less cited scientific concepts. There are no guarantees of truthful output when generating from the model. This extends to specific modalities such as citation prediction. While GALACTICA's citation behaviour approaches the ground truth citation behaviour with scale, the model continues to exhibit a popularity bias at larger scales.
In addition, we evaluated the model on several types of benchmarks related to stereotypes and toxicity. Overall, the model exhibits substantially lower toxicity rates compared to other large language models. That being said, the model continues to exhibit bias on certain measures (see the paper for details). So we recommend care when using the model for generations.
Broader Implications
--------------------
GALACTICA can potentially be used as a new way to discover academic literature. We also expect a lot of downstream use for application to particular domains, such as mathematics, biology, and chemistry. In the paper, we demonstrated several examples of the model acting as alternative to standard search tools. We expect a new generation of scientific tools to be built upon large language models such as GALACTICA.
We encourage researchers to investigate beneficial and new use cases for these models. That being said, it is important to be aware of the current limitations of large language models. Researchers should pay attention to common issues such as hallucination and biases that could emerge from using these models.
| [
"## Keywords\"\ninference: false\n\n\n\n\n---\n\n\n!logo\n\n\nGALACTICA 125M (mini)\n=====================\n\n\nModel card from the original repo\n\n\nFollowing Mitchell et al. (2018), this model card provides information about the GALACTICA model, how it was trained, and the intended use cases. Full details about how the model was trained and evaluated can be found in the release paper.\n\n\nModel Details\n-------------\n\n\nThe GALACTICA models are trained on a large-scale scientific corpus. The models are designed to perform scientific tasks, including but not limited to citation prediction, scientific QA, mathematical reasoning, summarization, document generation, molecular property prediction and entity extraction. The models were developed by the Papers with Code team at Meta AI to study the use of language models for the automatic organization of science. We train models with sizes ranging from 125M to 120B parameters. Below is a summary of the released models:\n\n\n\nRelease Date\n------------\n\n\nNovember 2022\n\n\nModel Type\n----------\n\n\nTransformer based architecture in a decoder-only setup with a few modifications (see paper for more details).\n\n\nPaper & Demo\n------------\n\n\nPaper / Demo\n\n\nModel Use\n---------\n\n\nThe primary intended users of the GALACTICA models are researchers studying language models applied to the scientific domain. We also anticipate the model will be useful for developers who wish to build scientific tooling. However, we caution against production use without safeguards given the potential of language models to hallucinate.\n\n\nThe models are made available under a non-commercial CC BY-NC 4.0 license. More information about how to use the model can be found in the URL of this repository.\n\n\nTraining Data\n-------------\n\n\nThe GALACTICA models are trained on 106 billion tokens of open-access scientific text and data. This includes papers, textbooks, scientific websites, encyclopedias, reference material, knowledge bases, and more. We tokenize different modalities to provide a natural langauge interface for different tasks. See the URL for more information. See the paper for full information on the training data.\n\n\nHow to use\n----------\n\n\nFind below some example scripts on how to use the model in 'transformers':\n\n\nUsing the Pytorch model\n-----------------------",
"### Running the model on a CPU\n\n\n\n Click to expand",
"### Running the model on a GPU\n\n\n\n Click to expand",
"### Running the model on a GPU using different precisions",
"#### FP16\n\n\n\n Click to expand",
"#### INT8\n\n\n\n Click to expand \n\nPerformance and Limitations\n---------------------------\n\n\nThe model outperforms several existing language models on a range of knowledge probes, reasoning, and knowledge-intensive scientific tasks. This also extends to general NLP tasks, where GALACTICA outperforms other open source general language models. That being said, we note a number of limitations in this section.\n\n\nAs with other language models, GALACTICA is often prone to hallucination - and training on a high-quality academic corpus does not prevent this, especially for less popular and less cited scientific concepts. There are no guarantees of truthful output when generating from the model. This extends to specific modalities such as citation prediction. While GALACTICA's citation behaviour approaches the ground truth citation behaviour with scale, the model continues to exhibit a popularity bias at larger scales.\n\n\nIn addition, we evaluated the model on several types of benchmarks related to stereotypes and toxicity. Overall, the model exhibits substantially lower toxicity rates compared to other large language models. That being said, the model continues to exhibit bias on certain measures (see the paper for details). So we recommend care when using the model for generations.\n\n\nBroader Implications\n--------------------\n\n\nGALACTICA can potentially be used as a new way to discover academic literature. We also expect a lot of downstream use for application to particular domains, such as mathematics, biology, and chemistry. In the paper, we demonstrated several examples of the model acting as alternative to standard search tools. We expect a new generation of scientific tools to be built upon large language models such as GALACTICA.\n\n\nWe encourage researchers to investigate beneficial and new use cases for these models. That being said, it is important to be aware of the current limitations of large language models. Researchers should pay attention to common issues such as hallucination and biases that could emerge from using these models."
] | [
"TAGS\n#transformers #safetensors #opt #text-generation #arxiv-1810.03993 #autotrain_compatible #endpoints_compatible #text-generation-inference #8-bit #region-us \n",
"## Keywords\"\ninference: false\n\n\n\n\n---\n\n\n!logo\n\n\nGALACTICA 125M (mini)\n=====================\n\n\nModel card from the original repo\n\n\nFollowing Mitchell et al. (2018), this model card provides information about the GALACTICA model, how it was trained, and the intended use cases. Full details about how the model was trained and evaluated can be found in the release paper.\n\n\nModel Details\n-------------\n\n\nThe GALACTICA models are trained on a large-scale scientific corpus. The models are designed to perform scientific tasks, including but not limited to citation prediction, scientific QA, mathematical reasoning, summarization, document generation, molecular property prediction and entity extraction. The models were developed by the Papers with Code team at Meta AI to study the use of language models for the automatic organization of science. We train models with sizes ranging from 125M to 120B parameters. Below is a summary of the released models:\n\n\n\nRelease Date\n------------\n\n\nNovember 2022\n\n\nModel Type\n----------\n\n\nTransformer based architecture in a decoder-only setup with a few modifications (see paper for more details).\n\n\nPaper & Demo\n------------\n\n\nPaper / Demo\n\n\nModel Use\n---------\n\n\nThe primary intended users of the GALACTICA models are researchers studying language models applied to the scientific domain. We also anticipate the model will be useful for developers who wish to build scientific tooling. However, we caution against production use without safeguards given the potential of language models to hallucinate.\n\n\nThe models are made available under a non-commercial CC BY-NC 4.0 license. More information about how to use the model can be found in the URL of this repository.\n\n\nTraining Data\n-------------\n\n\nThe GALACTICA models are trained on 106 billion tokens of open-access scientific text and data. This includes papers, textbooks, scientific websites, encyclopedias, reference material, knowledge bases, and more. We tokenize different modalities to provide a natural langauge interface for different tasks. See the URL for more information. See the paper for full information on the training data.\n\n\nHow to use\n----------\n\n\nFind below some example scripts on how to use the model in 'transformers':\n\n\nUsing the Pytorch model\n-----------------------",
"### Running the model on a CPU\n\n\n\n Click to expand",
"### Running the model on a GPU\n\n\n\n Click to expand",
"### Running the model on a GPU using different precisions",
"#### FP16\n\n\n\n Click to expand",
"#### INT8\n\n\n\n Click to expand \n\nPerformance and Limitations\n---------------------------\n\n\nThe model outperforms several existing language models on a range of knowledge probes, reasoning, and knowledge-intensive scientific tasks. This also extends to general NLP tasks, where GALACTICA outperforms other open source general language models. That being said, we note a number of limitations in this section.\n\n\nAs with other language models, GALACTICA is often prone to hallucination - and training on a high-quality academic corpus does not prevent this, especially for less popular and less cited scientific concepts. There are no guarantees of truthful output when generating from the model. This extends to specific modalities such as citation prediction. While GALACTICA's citation behaviour approaches the ground truth citation behaviour with scale, the model continues to exhibit a popularity bias at larger scales.\n\n\nIn addition, we evaluated the model on several types of benchmarks related to stereotypes and toxicity. Overall, the model exhibits substantially lower toxicity rates compared to other large language models. That being said, the model continues to exhibit bias on certain measures (see the paper for details). So we recommend care when using the model for generations.\n\n\nBroader Implications\n--------------------\n\n\nGALACTICA can potentially be used as a new way to discover academic literature. We also expect a lot of downstream use for application to particular domains, such as mathematics, biology, and chemistry. In the paper, we demonstrated several examples of the model acting as alternative to standard search tools. We expect a new generation of scientific tools to be built upon large language models such as GALACTICA.\n\n\nWe encourage researchers to investigate beneficial and new use cases for these models. That being said, it is important to be aware of the current limitations of large language models. Researchers should pay attention to common issues such as hallucination and biases that could emerge from using these models."
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | golf2248/qvy8fl3 | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T22:10:23+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers | Quantization made by Richard Erkhov.
[Github](https://github.com/RichardErkhov)
[Discord](https://discord.gg/pvy7H8DZMG)
[Request more models](https://github.com/RichardErkhov/quant_request)
xglm-4.5B - bnb 4bits
- Model creator: https://huggingface.co/facebook/
- Original model: https://huggingface.co/facebook/xglm-4.5B/
Original model description:
---
language:
- multilingual
- en
- ru
- zh
- de
- es
- fr
- ja
- it
- pt
- el
- ko
- fi
- id
- tr
- ar
- vi
- th
- bg
- ca
- hi
- et
- bn
- ta
- ur
- sw
- te
- eu
- my
- ht
- qu
license: mit
thumbnail: https://huggingface.co/front/thumbnails/facebook.png
inference: false
---
# XGLM-4.5B
XGLM-4.5B is a multilingual autoregressive language model (with 4.5 billion parameters) trained on a balanced corpus of a diverse set of 134 languages. It was introduced in the paper [Few-shot Learning with Multilingual Language Models](https://arxiv.org/abs/2112.10668) by Xi Victoria Lin\*, Todor Mihaylov, Mikel Artetxe, Tianlu Wang, Shuohui Chen, Daniel Simig, Myle Ott, Naman Goyal, Shruti Bhosale, Jingfei Du, Ramakanth Pasunuru, Sam Shleifer, Punit Singh Koura, Vishrav Chaudhary, Brian O'Horo, Jeff Wang, Luke Zettlemoyer, Zornitsa Kozareva, Mona Diab, Veselin Stoyanov, Xian Li\* (\*Equal Contribution). The original implementation was released in [this repository](https://github.com/pytorch/fairseq/tree/main/examples/xglm).
## Model card
For intended usage of the model, please refer to the [model card](https://github.com/pytorch/fairseq/blob/main/examples/xglm/model_card.md) released by the XGLM-4.5B development team.
## Example (COPA)
The following snippet shows how to evaluate our models (GPT-3 style, zero-shot) on the Choice of Plausible Alternatives (COPA) task, using examples in English, Chinese and Hindi.
```python
import torch
import torch.nn.functional as F
from transformers import XGLMTokenizer, XGLMForCausalLM
tokenizer = XGLMTokenizer.from_pretrained("facebook/xglm-4.5B")
model = XGLMForCausalLM.from_pretrained("facebook/xglm-4.5B")
data_samples = {
'en': [
{
"premise": "I wanted to conserve energy.",
"choice1": "I swept the floor in the unoccupied room.",
"choice2": "I shut off the light in the unoccupied room.",
"question": "effect",
"label": "1"
},
{
"premise": "The flame on the candle went out.",
"choice1": "I blew on the wick.",
"choice2": "I put a match to the wick.",
"question": "cause",
"label": "0"
}
],
'zh': [
{
"premise": "我想节约能源。",
"choice1": "我在空着的房间里扫了地板。",
"choice2": "我把空房间里的灯关了。",
"question": "effect",
"label": "1"
},
{
"premise": "蜡烛上的火焰熄灭了。",
"choice1": "我吹灭了灯芯。",
"choice2": "我把一根火柴放在灯芯上。",
"question": "cause",
"label": "0"
}
],
'hi': [
{
"premise": "M te vle konsève enèji.",
"choice1": "Mwen te fin baleye chanm lib la.",
"choice2": "Mwen te femen limyè nan chanm lib la.",
"question": "effect",
"label": "1"
},
{
"premise": "Flam bouji a te etenn.",
"choice1": "Mwen te soufle bouji a.",
"choice2": "Mwen te limen mèch bouji a.",
"question": "cause",
"label": "0"
}
]
}
def get_logprobs(prompt):
inputs = tokenizer(prompt, return_tensors="pt")
input_ids, output_ids = inputs["input_ids"], inputs["input_ids"][:, 1:]
outputs = model(**inputs, labels=input_ids)
logits = outputs.logits
logprobs = torch.gather(F.log_softmax(logits, dim=2), 2, output_ids.unsqueeze(2))
return logprobs
# Zero-shot evaluation for the Choice of Plausible Alternatives (COPA) task.
# A return value of 0 indicates that the first alternative is more plausible,
# while 1 indicates that the second alternative is more plausible.
def COPA_eval(prompt, alternative1, alternative2):
lprob1 = get_logprobs(prompt + "\n" + alternative1).sum()
lprob2 = get_logprobs(prompt + "\n" + alternative2).sum()
return 0 if lprob1 > lprob2 else 1
for lang in data_samples_long:
for idx, example in enumerate(data_samples_long[lang]):
predict = COPA_eval(example["premise"], example["choice1"], example["choice2"])
print(f'{lang}-{idx}', predict, example['label'])
# en-0 1 1
# en-1 0 0
# zh-0 1 1
# zh-1 0 0
# hi-0 1 1
# hi-1 0 0
```
| {} | RichardErkhov/facebook_-_xglm-4.5B-4bits | null | [
"transformers",
"safetensors",
"xglm",
"text-generation",
"arxiv:2112.10668",
"autotrain_compatible",
"endpoints_compatible",
"4-bit",
"region:us"
] | null | 2024-04-28T22:11:08+00:00 | [
"2112.10668"
] | [] | TAGS
#transformers #safetensors #xglm #text-generation #arxiv-2112.10668 #autotrain_compatible #endpoints_compatible #4-bit #region-us
| Quantization made by Richard Erkhov.
Github
Discord
Request more models
xglm-4.5B - bnb 4bits
- Model creator: URL
- Original model: URL
Original model description:
---
language:
- multilingual
- en
- ru
- zh
- de
- es
- fr
- ja
- it
- pt
- el
- ko
- fi
- id
- tr
- ar
- vi
- th
- bg
- ca
- hi
- et
- bn
- ta
- ur
- sw
- te
- eu
- my
- ht
- qu
license: mit
thumbnail: URL
inference: false
---
# XGLM-4.5B
XGLM-4.5B is a multilingual autoregressive language model (with 4.5 billion parameters) trained on a balanced corpus of a diverse set of 134 languages. It was introduced in the paper Few-shot Learning with Multilingual Language Models by Xi Victoria Lin\*, Todor Mihaylov, Mikel Artetxe, Tianlu Wang, Shuohui Chen, Daniel Simig, Myle Ott, Naman Goyal, Shruti Bhosale, Jingfei Du, Ramakanth Pasunuru, Sam Shleifer, Punit Singh Koura, Vishrav Chaudhary, Brian O'Horo, Jeff Wang, Luke Zettlemoyer, Zornitsa Kozareva, Mona Diab, Veselin Stoyanov, Xian Li\* (\*Equal Contribution). The original implementation was released in this repository.
## Model card
For intended usage of the model, please refer to the model card released by the XGLM-4.5B development team.
## Example (COPA)
The following snippet shows how to evaluate our models (GPT-3 style, zero-shot) on the Choice of Plausible Alternatives (COPA) task, using examples in English, Chinese and Hindi.
| [
"# XGLM-4.5B\n\nXGLM-4.5B is a multilingual autoregressive language model (with 4.5 billion parameters) trained on a balanced corpus of a diverse set of 134 languages. It was introduced in the paper Few-shot Learning with Multilingual Language Models by Xi Victoria Lin\\*, Todor Mihaylov, Mikel Artetxe, Tianlu Wang, Shuohui Chen, Daniel Simig, Myle Ott, Naman Goyal, Shruti Bhosale, Jingfei Du, Ramakanth Pasunuru, Sam Shleifer, Punit Singh Koura, Vishrav Chaudhary, Brian O'Horo, Jeff Wang, Luke Zettlemoyer, Zornitsa Kozareva, Mona Diab, Veselin Stoyanov, Xian Li\\* (\\*Equal Contribution). The original implementation was released in this repository.",
"## Model card\n\nFor intended usage of the model, please refer to the model card released by the XGLM-4.5B development team.",
"## Example (COPA)\nThe following snippet shows how to evaluate our models (GPT-3 style, zero-shot) on the Choice of Plausible Alternatives (COPA) task, using examples in English, Chinese and Hindi."
] | [
"TAGS\n#transformers #safetensors #xglm #text-generation #arxiv-2112.10668 #autotrain_compatible #endpoints_compatible #4-bit #region-us \n",
"# XGLM-4.5B\n\nXGLM-4.5B is a multilingual autoregressive language model (with 4.5 billion parameters) trained on a balanced corpus of a diverse set of 134 languages. It was introduced in the paper Few-shot Learning with Multilingual Language Models by Xi Victoria Lin\\*, Todor Mihaylov, Mikel Artetxe, Tianlu Wang, Shuohui Chen, Daniel Simig, Myle Ott, Naman Goyal, Shruti Bhosale, Jingfei Du, Ramakanth Pasunuru, Sam Shleifer, Punit Singh Koura, Vishrav Chaudhary, Brian O'Horo, Jeff Wang, Luke Zettlemoyer, Zornitsa Kozareva, Mona Diab, Veselin Stoyanov, Xian Li\\* (\\*Equal Contribution). The original implementation was released in this repository.",
"## Model card\n\nFor intended usage of the model, please refer to the model card released by the XGLM-4.5B development team.",
"## Example (COPA)\nThe following snippet shows how to evaluate our models (GPT-3 style, zero-shot) on the Choice of Plausible Alternatives (COPA) task, using examples in English, Chinese and Hindi."
] |
text-generation | transformers |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# full_finetuned-code-tinyllama
This model is a fine-tuned version of [TinyLlama/TinyLlama-1.1B-Chat-v1.0](https://huggingface.co/TinyLlama/TinyLlama-1.1B-Chat-v1.0) on the generator dataset.
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 2e-05
- train_batch_size: 4
- eval_batch_size: 8
- seed: 42
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: constant
- lr_scheduler_warmup_ratio: 0.03
- num_epochs: 4
### Training results
### Framework versions
- Transformers 4.31.0
- Pytorch 2.3.0+cu121
- Datasets 2.19.0
- Tokenizers 0.13.3
| {"license": "apache-2.0", "tags": ["trl", "sft", "generated_from_trainer"], "datasets": ["generator"], "base_model": "TinyLlama/TinyLlama-1.1B-Chat-v1.0", "model-index": [{"name": "full_finetuned-code-tinyllama", "results": []}]} | anudaw/full_finetuned-code-tinyllama | null | [
"transformers",
"pytorch",
"llama",
"text-generation",
"trl",
"sft",
"generated_from_trainer",
"conversational",
"dataset:generator",
"base_model:TinyLlama/TinyLlama-1.1B-Chat-v1.0",
"license:apache-2.0",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T22:13:25+00:00 | [] | [] | TAGS
#transformers #pytorch #llama #text-generation #trl #sft #generated_from_trainer #conversational #dataset-generator #base_model-TinyLlama/TinyLlama-1.1B-Chat-v1.0 #license-apache-2.0 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
|
# full_finetuned-code-tinyllama
This model is a fine-tuned version of TinyLlama/TinyLlama-1.1B-Chat-v1.0 on the generator dataset.
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 2e-05
- train_batch_size: 4
- eval_batch_size: 8
- seed: 42
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: constant
- lr_scheduler_warmup_ratio: 0.03
- num_epochs: 4
### Training results
### Framework versions
- Transformers 4.31.0
- Pytorch 2.3.0+cu121
- Datasets 2.19.0
- Tokenizers 0.13.3
| [
"# full_finetuned-code-tinyllama\n\nThis model is a fine-tuned version of TinyLlama/TinyLlama-1.1B-Chat-v1.0 on the generator dataset.",
"## Model description\n\nMore information needed",
"## Intended uses & limitations\n\nMore information needed",
"## Training and evaluation data\n\nMore information needed",
"## Training procedure",
"### Training hyperparameters\n\nThe following hyperparameters were used during training:\n- learning_rate: 2e-05\n- train_batch_size: 4\n- eval_batch_size: 8\n- seed: 42\n- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n- lr_scheduler_type: constant\n- lr_scheduler_warmup_ratio: 0.03\n- num_epochs: 4",
"### Training results",
"### Framework versions\n\n- Transformers 4.31.0\n- Pytorch 2.3.0+cu121\n- Datasets 2.19.0\n- Tokenizers 0.13.3"
] | [
"TAGS\n#transformers #pytorch #llama #text-generation #trl #sft #generated_from_trainer #conversational #dataset-generator #base_model-TinyLlama/TinyLlama-1.1B-Chat-v1.0 #license-apache-2.0 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# full_finetuned-code-tinyllama\n\nThis model is a fine-tuned version of TinyLlama/TinyLlama-1.1B-Chat-v1.0 on the generator dataset.",
"## Model description\n\nMore information needed",
"## Intended uses & limitations\n\nMore information needed",
"## Training and evaluation data\n\nMore information needed",
"## Training procedure",
"### Training hyperparameters\n\nThe following hyperparameters were used during training:\n- learning_rate: 2e-05\n- train_batch_size: 4\n- eval_batch_size: 8\n- seed: 42\n- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n- lr_scheduler_type: constant\n- lr_scheduler_warmup_ratio: 0.03\n- num_epochs: 4",
"### Training results",
"### Framework versions\n\n- Transformers 4.31.0\n- Pytorch 2.3.0+cu121\n- Datasets 2.19.0\n- Tokenizers 0.13.3"
] |
text-generation | transformers | # flammenai/flammen22C-mistral-7B AWQ
- Model creator: [flammenai](https://huggingface.co/flammenai)
- Original model: [flammen22C-mistral-7B](https://huggingface.co/flammenai/flammen22C-mistral-7B)

## Model Summary
A Mistral 7B LLM built from merging pretrained models and finetuning on [flammenai/casual-conversation-DPO](https://huggingface.co/datasets/flammenai/casual-conversation-DPO).
Flammen specializes in exceptional character roleplay, creative writing, and general intelligence
### Method
Finetuned using an A100 on Google Colab.
[Fine-tune a Mistral-7b model with Direct Preference Optimization](https://towardsdatascience.com/fine-tune-a-mistral-7b-model-with-direct-preference-optimization-708042745aac) - [Maxime Labonne](https://huggingface.co/mlabonne)
## How to use
### Install the necessary packages
```bash
pip install --upgrade autoawq autoawq-kernels
```
### Example Python code
```python
from awq import AutoAWQForCausalLM
from transformers import AutoTokenizer, TextStreamer
model_path = "solidrust/flammen22C-mistral-7B-AWQ"
system_message = "You are flammen22C-mistral-7B, incarnated as a powerful AI. You were created by flammenai."
# Load model
model = AutoAWQForCausalLM.from_quantized(model_path,
fuse_layers=True)
tokenizer = AutoTokenizer.from_pretrained(model_path,
trust_remote_code=True)
streamer = TextStreamer(tokenizer,
skip_prompt=True,
skip_special_tokens=True)
# Convert prompt to tokens
prompt_template = """\
<|im_start|>system
{system_message}<|im_end|>
<|im_start|>user
{prompt}<|im_end|>
<|im_start|>assistant"""
prompt = "You're standing on the surface of the Earth. "\
"You walk one mile south, one mile west and one mile north. "\
"You end up exactly where you started. Where are you?"
tokens = tokenizer(prompt_template.format(system_message=system_message,prompt=prompt),
return_tensors='pt').input_ids.cuda()
# Generate output
generation_output = model.generate(tokens,
streamer=streamer,
max_new_tokens=512)
```
### About AWQ
AWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.
AWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.
It is supported by:
- [Text Generation Webui](https://github.com/oobabooga/text-generation-webui) - using Loader: AutoAWQ
- [vLLM](https://github.com/vllm-project/vllm) - version 0.2.2 or later for support for all model types.
- [Hugging Face Text Generation Inference (TGI)](https://github.com/huggingface/text-generation-inference)
- [Transformers](https://huggingface.co/docs/transformers) version 4.35.0 and later, from any code or client that supports Transformers
- [AutoAWQ](https://github.com/casper-hansen/AutoAWQ) - for use from Python code
| {"license": "apache-2.0", "library_name": "transformers", "tags": ["4-bit", "AWQ", "text-generation", "autotrain_compatible", "endpoints_compatible"], "datasets": ["flammenai/casual-conversation-DPO"], "base_model": ["flammenai/flammen22-mistral-7B"], "pipeline_tag": "text-generation", "inference": false, "quantized_by": "Suparious"} | solidrust/flammen22C-mistral-7B-AWQ | null | [
"transformers",
"safetensors",
"mistral",
"text-generation",
"4-bit",
"AWQ",
"autotrain_compatible",
"endpoints_compatible",
"dataset:flammenai/casual-conversation-DPO",
"base_model:flammenai/flammen22-mistral-7B",
"license:apache-2.0",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T22:15:15+00:00 | [] | [] | TAGS
#transformers #safetensors #mistral #text-generation #4-bit #AWQ #autotrain_compatible #endpoints_compatible #dataset-flammenai/casual-conversation-DPO #base_model-flammenai/flammen22-mistral-7B #license-apache-2.0 #text-generation-inference #region-us
| # flammenai/flammen22C-mistral-7B AWQ
- Model creator: flammenai
- Original model: flammen22C-mistral-7B
!image/png
## Model Summary
A Mistral 7B LLM built from merging pretrained models and finetuning on flammenai/casual-conversation-DPO.
Flammen specializes in exceptional character roleplay, creative writing, and general intelligence
### Method
Finetuned using an A100 on Google Colab.
Fine-tune a Mistral-7b model with Direct Preference Optimization - Maxime Labonne
## How to use
### Install the necessary packages
### Example Python code
### About AWQ
AWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.
AWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.
It is supported by:
- Text Generation Webui - using Loader: AutoAWQ
- vLLM - version 0.2.2 or later for support for all model types.
- Hugging Face Text Generation Inference (TGI)
- Transformers version 4.35.0 and later, from any code or client that supports Transformers
- AutoAWQ - for use from Python code
| [
"# flammenai/flammen22C-mistral-7B AWQ\n\n- Model creator: flammenai\n- Original model: flammen22C-mistral-7B\n\n!image/png",
"## Model Summary\n\nA Mistral 7B LLM built from merging pretrained models and finetuning on flammenai/casual-conversation-DPO. \nFlammen specializes in exceptional character roleplay, creative writing, and general intelligence",
"### Method\n\nFinetuned using an A100 on Google Colab.\n\nFine-tune a Mistral-7b model with Direct Preference Optimization - Maxime Labonne",
"## How to use",
"### Install the necessary packages",
"### Example Python code",
"### About AWQ\n\nAWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.\n\nAWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.\n\nIt is supported by:\n\n- Text Generation Webui - using Loader: AutoAWQ\n- vLLM - version 0.2.2 or later for support for all model types.\n- Hugging Face Text Generation Inference (TGI)\n- Transformers version 4.35.0 and later, from any code or client that supports Transformers\n- AutoAWQ - for use from Python code"
] | [
"TAGS\n#transformers #safetensors #mistral #text-generation #4-bit #AWQ #autotrain_compatible #endpoints_compatible #dataset-flammenai/casual-conversation-DPO #base_model-flammenai/flammen22-mistral-7B #license-apache-2.0 #text-generation-inference #region-us \n",
"# flammenai/flammen22C-mistral-7B AWQ\n\n- Model creator: flammenai\n- Original model: flammen22C-mistral-7B\n\n!image/png",
"## Model Summary\n\nA Mistral 7B LLM built from merging pretrained models and finetuning on flammenai/casual-conversation-DPO. \nFlammen specializes in exceptional character roleplay, creative writing, and general intelligence",
"### Method\n\nFinetuned using an A100 on Google Colab.\n\nFine-tune a Mistral-7b model with Direct Preference Optimization - Maxime Labonne",
"## How to use",
"### Install the necessary packages",
"### Example Python code",
"### About AWQ\n\nAWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.\n\nAWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.\n\nIt is supported by:\n\n- Text Generation Webui - using Loader: AutoAWQ\n- vLLM - version 0.2.2 or later for support for all model types.\n- Hugging Face Text Generation Inference (TGI)\n- Transformers version 4.35.0 and later, from any code or client that supports Transformers\n- AutoAWQ - for use from Python code"
] |
text-classification | transformers |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# results
This model is a fine-tuned version of [cardiffnlp/twitter-xlm-roberta-base](https://huggingface.co/cardiffnlp/twitter-xlm-roberta-base) on the None dataset.
It achieves the following results on the evaluation set:
- eval_loss: 0.3651
- eval_label_0_f1: 0.7305
- eval_label_0_accuracy: 0.9498
- eval_label_1_f1: 0.8458
- eval_label_1_accuracy: 0.8573
- eval_label_2_f1: 0.7816
- eval_label_2_accuracy: 0.9576
- eval_label_3_f1: 0.7638
- eval_label_3_accuracy: 0.9097
- eval_label_4_f1: 0.6438
- eval_label_4_accuracy: 0.9420
- eval_label_5_f1: 0.6857
- eval_label_5_accuracy: 0.9755
- eval_runtime: 5.7337
- eval_samples_per_second: 156.444
- eval_steps_per_second: 5.058
- epoch: 5.0
- step: 795
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 1e-05
- train_batch_size: 32
- eval_batch_size: 32
- seed: 42
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: linear
- num_epochs: 10
### Framework versions
- Transformers 4.39.3
- Pytorch 2.1.2
- Datasets 2.18.0
- Tokenizers 0.15.2
| {"tags": ["generated_from_trainer"], "base_model": "cardiffnlp/twitter-xlm-roberta-base", "model-index": [{"name": "results", "results": []}]} | parhamabedazad/results | null | [
"transformers",
"tensorboard",
"safetensors",
"xlm-roberta",
"text-classification",
"generated_from_trainer",
"base_model:cardiffnlp/twitter-xlm-roberta-base",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T22:16:08+00:00 | [] | [] | TAGS
#transformers #tensorboard #safetensors #xlm-roberta #text-classification #generated_from_trainer #base_model-cardiffnlp/twitter-xlm-roberta-base #autotrain_compatible #endpoints_compatible #region-us
|
# results
This model is a fine-tuned version of cardiffnlp/twitter-xlm-roberta-base on the None dataset.
It achieves the following results on the evaluation set:
- eval_loss: 0.3651
- eval_label_0_f1: 0.7305
- eval_label_0_accuracy: 0.9498
- eval_label_1_f1: 0.8458
- eval_label_1_accuracy: 0.8573
- eval_label_2_f1: 0.7816
- eval_label_2_accuracy: 0.9576
- eval_label_3_f1: 0.7638
- eval_label_3_accuracy: 0.9097
- eval_label_4_f1: 0.6438
- eval_label_4_accuracy: 0.9420
- eval_label_5_f1: 0.6857
- eval_label_5_accuracy: 0.9755
- eval_runtime: 5.7337
- eval_samples_per_second: 156.444
- eval_steps_per_second: 5.058
- epoch: 5.0
- step: 795
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 1e-05
- train_batch_size: 32
- eval_batch_size: 32
- seed: 42
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: linear
- num_epochs: 10
### Framework versions
- Transformers 4.39.3
- Pytorch 2.1.2
- Datasets 2.18.0
- Tokenizers 0.15.2
| [
"# results\n\nThis model is a fine-tuned version of cardiffnlp/twitter-xlm-roberta-base on the None dataset.\nIt achieves the following results on the evaluation set:\n- eval_loss: 0.3651\n- eval_label_0_f1: 0.7305\n- eval_label_0_accuracy: 0.9498\n- eval_label_1_f1: 0.8458\n- eval_label_1_accuracy: 0.8573\n- eval_label_2_f1: 0.7816\n- eval_label_2_accuracy: 0.9576\n- eval_label_3_f1: 0.7638\n- eval_label_3_accuracy: 0.9097\n- eval_label_4_f1: 0.6438\n- eval_label_4_accuracy: 0.9420\n- eval_label_5_f1: 0.6857\n- eval_label_5_accuracy: 0.9755\n- eval_runtime: 5.7337\n- eval_samples_per_second: 156.444\n- eval_steps_per_second: 5.058\n- epoch: 5.0\n- step: 795",
"## Model description\n\nMore information needed",
"## Intended uses & limitations\n\nMore information needed",
"## Training and evaluation data\n\nMore information needed",
"## Training procedure",
"### Training hyperparameters\n\nThe following hyperparameters were used during training:\n- learning_rate: 1e-05\n- train_batch_size: 32\n- eval_batch_size: 32\n- seed: 42\n- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n- lr_scheduler_type: linear\n- num_epochs: 10",
"### Framework versions\n\n- Transformers 4.39.3\n- Pytorch 2.1.2\n- Datasets 2.18.0\n- Tokenizers 0.15.2"
] | [
"TAGS\n#transformers #tensorboard #safetensors #xlm-roberta #text-classification #generated_from_trainer #base_model-cardiffnlp/twitter-xlm-roberta-base #autotrain_compatible #endpoints_compatible #region-us \n",
"# results\n\nThis model is a fine-tuned version of cardiffnlp/twitter-xlm-roberta-base on the None dataset.\nIt achieves the following results on the evaluation set:\n- eval_loss: 0.3651\n- eval_label_0_f1: 0.7305\n- eval_label_0_accuracy: 0.9498\n- eval_label_1_f1: 0.8458\n- eval_label_1_accuracy: 0.8573\n- eval_label_2_f1: 0.7816\n- eval_label_2_accuracy: 0.9576\n- eval_label_3_f1: 0.7638\n- eval_label_3_accuracy: 0.9097\n- eval_label_4_f1: 0.6438\n- eval_label_4_accuracy: 0.9420\n- eval_label_5_f1: 0.6857\n- eval_label_5_accuracy: 0.9755\n- eval_runtime: 5.7337\n- eval_samples_per_second: 156.444\n- eval_steps_per_second: 5.058\n- epoch: 5.0\n- step: 795",
"## Model description\n\nMore information needed",
"## Intended uses & limitations\n\nMore information needed",
"## Training and evaluation data\n\nMore information needed",
"## Training procedure",
"### Training hyperparameters\n\nThe following hyperparameters were used during training:\n- learning_rate: 1e-05\n- train_batch_size: 32\n- eval_batch_size: 32\n- seed: 42\n- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n- lr_scheduler_type: linear\n- num_epochs: 10",
"### Framework versions\n\n- Transformers 4.39.3\n- Pytorch 2.1.2\n- Datasets 2.18.0\n- Tokenizers 0.15.2"
] |
text-generation | transformers | # flammenai/flammen22-mistral-7B AWQ
- Model creator: [flammenai](https://huggingface.co/flammenai)
- Original model: [flammen22-mistral-7B](https://huggingface.co/flammenai/flammen22-mistral-7B)

## Model Summary
A Mistral 7B LLM built from merging pretrained models and finetuning on [Doctor-Shotgun/theory-of-mind-dpo](https://huggingface.co/datasets/Doctor-Shotgun/theory-of-mind-dpo).
Flammen specializes in exceptional character roleplay, creative writing, and general intelligence
Finetuned using an A100 on Google Colab.
[Fine-tune a Mistral-7b model with Direct Preference Optimization](https://towardsdatascience.com/fine-tune-a-mistral-7b-model-with-direct-preference-optimization-708042745aac) - [Maxime Labonne](https://huggingface.co/mlabonne)
## How to use
### Install the necessary packages
```bash
pip install --upgrade autoawq autoawq-kernels
```
### Example Python code
```python
from awq import AutoAWQForCausalLM
from transformers import AutoTokenizer, TextStreamer
model_path = "solidrust/flammen22-mistral-7B-AWQ"
system_message = "You are flammen22-mistral-7B, incarnated as a powerful AI. You were created by flammenai."
# Load model
model = AutoAWQForCausalLM.from_quantized(model_path,
fuse_layers=True)
tokenizer = AutoTokenizer.from_pretrained(model_path,
trust_remote_code=True)
streamer = TextStreamer(tokenizer,
skip_prompt=True,
skip_special_tokens=True)
# Convert prompt to tokens
prompt_template = """\
<|im_start|>system
{system_message}<|im_end|>
<|im_start|>user
{prompt}<|im_end|>
<|im_start|>assistant"""
prompt = "You're standing on the surface of the Earth. "\
"You walk one mile south, one mile west and one mile north. "\
"You end up exactly where you started. Where are you?"
tokens = tokenizer(prompt_template.format(system_message=system_message,prompt=prompt),
return_tensors='pt').input_ids.cuda()
# Generate output
generation_output = model.generate(tokens,
streamer=streamer,
max_new_tokens=512)
```
### About AWQ
AWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.
AWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.
It is supported by:
- [Text Generation Webui](https://github.com/oobabooga/text-generation-webui) - using Loader: AutoAWQ
- [vLLM](https://github.com/vllm-project/vllm) - version 0.2.2 or later for support for all model types.
- [Hugging Face Text Generation Inference (TGI)](https://github.com/huggingface/text-generation-inference)
- [Transformers](https://huggingface.co/docs/transformers) version 4.35.0 and later, from any code or client that supports Transformers
- [AutoAWQ](https://github.com/casper-hansen/AutoAWQ) - for use from Python code
| {"license": "apache-2.0", "library_name": "transformers", "tags": ["4-bit", "AWQ", "text-generation", "autotrain_compatible", "endpoints_compatible"], "datasets": ["Doctor-Shotgun/theory-of-mind-dpo"], "base_model": ["flammenai/flammen21X-mistral-7B"], "pipeline_tag": "text-generation", "inference": false, "quantized_by": "Suparious"} | solidrust/flammen22-mistral-7B-AWQ | null | [
"transformers",
"safetensors",
"mistral",
"text-generation",
"4-bit",
"AWQ",
"autotrain_compatible",
"endpoints_compatible",
"dataset:Doctor-Shotgun/theory-of-mind-dpo",
"base_model:flammenai/flammen21X-mistral-7B",
"license:apache-2.0",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T22:18:05+00:00 | [] | [] | TAGS
#transformers #safetensors #mistral #text-generation #4-bit #AWQ #autotrain_compatible #endpoints_compatible #dataset-Doctor-Shotgun/theory-of-mind-dpo #base_model-flammenai/flammen21X-mistral-7B #license-apache-2.0 #text-generation-inference #region-us
| # flammenai/flammen22-mistral-7B AWQ
- Model creator: flammenai
- Original model: flammen22-mistral-7B
!image/png
## Model Summary
A Mistral 7B LLM built from merging pretrained models and finetuning on Doctor-Shotgun/theory-of-mind-dpo.
Flammen specializes in exceptional character roleplay, creative writing, and general intelligence
Finetuned using an A100 on Google Colab.
Fine-tune a Mistral-7b model with Direct Preference Optimization - Maxime Labonne
## How to use
### Install the necessary packages
### Example Python code
### About AWQ
AWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.
AWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.
It is supported by:
- Text Generation Webui - using Loader: AutoAWQ
- vLLM - version 0.2.2 or later for support for all model types.
- Hugging Face Text Generation Inference (TGI)
- Transformers version 4.35.0 and later, from any code or client that supports Transformers
- AutoAWQ - for use from Python code
| [
"# flammenai/flammen22-mistral-7B AWQ\n\n- Model creator: flammenai\n- Original model: flammen22-mistral-7B\n\n!image/png",
"## Model Summary\n\nA Mistral 7B LLM built from merging pretrained models and finetuning on Doctor-Shotgun/theory-of-mind-dpo. \nFlammen specializes in exceptional character roleplay, creative writing, and general intelligence\n\nFinetuned using an A100 on Google Colab.\n\nFine-tune a Mistral-7b model with Direct Preference Optimization - Maxime Labonne",
"## How to use",
"### Install the necessary packages",
"### Example Python code",
"### About AWQ\n\nAWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.\n\nAWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.\n\nIt is supported by:\n\n- Text Generation Webui - using Loader: AutoAWQ\n- vLLM - version 0.2.2 or later for support for all model types.\n- Hugging Face Text Generation Inference (TGI)\n- Transformers version 4.35.0 and later, from any code or client that supports Transformers\n- AutoAWQ - for use from Python code"
] | [
"TAGS\n#transformers #safetensors #mistral #text-generation #4-bit #AWQ #autotrain_compatible #endpoints_compatible #dataset-Doctor-Shotgun/theory-of-mind-dpo #base_model-flammenai/flammen21X-mistral-7B #license-apache-2.0 #text-generation-inference #region-us \n",
"# flammenai/flammen22-mistral-7B AWQ\n\n- Model creator: flammenai\n- Original model: flammen22-mistral-7B\n\n!image/png",
"## Model Summary\n\nA Mistral 7B LLM built from merging pretrained models and finetuning on Doctor-Shotgun/theory-of-mind-dpo. \nFlammen specializes in exceptional character roleplay, creative writing, and general intelligence\n\nFinetuned using an A100 on Google Colab.\n\nFine-tune a Mistral-7b model with Direct Preference Optimization - Maxime Labonne",
"## How to use",
"### Install the necessary packages",
"### Example Python code",
"### About AWQ\n\nAWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.\n\nAWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.\n\nIt is supported by:\n\n- Text Generation Webui - using Loader: AutoAWQ\n- vLLM - version 0.2.2 or later for support for all model types.\n- Hugging Face Text Generation Inference (TGI)\n- Transformers version 4.35.0 and later, from any code or client that supports Transformers\n- AutoAWQ - for use from Python code"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | quickstep3621/sfckfq4 | null | [
"transformers",
"safetensors",
"stablelm",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T22:20:18+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #stablelm #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #stablelm #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
null | transformers |
[<img src="https://ai.hooking.co.il/upload/images/logo/0qUf-dashboard-hookingai-logo.png"/>](https://software.hooking.ltd/)
# Model Card for Monah-8b-gguf
**This is en Experimental model**
## Model Description
- **Developed by:** hooking AI
- **License:** Apache-2.0
- **Original Model:** [Monah-8b](https://huggingface.co/hooking-dev/Monah-8b)
- **Purpose:** The Monah-8b model is designed to generate high-quality, contextually relevant text for various applications.
- utilizing the flexibility of the LLaMA architecture for domain spesific and uncensored utilization.
## Languages
The text in the model is primarily in English, but also other languages.
## Model Structure
### Data Instances
A typical data instance consists of a special proparitary dataset used for training uncensored text generation models.
## Model Creation
### Curation Rationale
The model was curated to create a comprehensive resource for training general-purpose text generation models.
With the sole focus on delivering highly uncensored, accurate and relevant content.
### Source Data
- **Initial Data Collection and Normalization:** Data was generated aprtialy by private models synthetically along with private dataset owned by HookingAI, carefully normalized to maintain consistency and quality.
- **Who are the source language producers?** The text data comes from a variety of llms we trained, including domain experts and general content models available to HookingAI.
-
## Considerations for Using the Data
**This model is not for kids!!**
**The content is uncensored!!**
### Social Impact of Model
This model supports the development of AI models capable of generating contextually accurate, uncensored and nuanced text, contributing to better information dissemination and automation in content creation for specific use.
### Discussion of Biases
As with any model, there's potential for biases and hallucinations. **Also the content may be sexual or illeagal.** Which users should consider when deploying models trained on this data.
### Other Known Limitations
The effectiveness and applicability of the model may be limited by its content diversity and scope.
## Additional Information
**Model Quantization Table**
| Name | Quant method | Bits | Size | Max RAM required | Use case |
| --- | --- | --- | --- | --- | --- |
| SexyLlama-8b-gguf.Q2_K.gguf | Q2_K | 2 | 3.18 GB | 5.66 GB | significant quality loss - not recommended for most purpose |
| SexyLlama-8b-gguf.Q3_K_M.gguf | Q3_K_M | 3 | 4.02 GB | 6.41 GB GB | very small, high quality loss |
| SexyLlama-8b-gguf.Q4_K_S.gguf | Q4_K_S | 4 | 4.69 GB | 6.97 GB | small, greater quality loss |
| SexyLlama-8b-gguf.Q4_K_M.gguf | Q4_K_M | 4 | 4.92 GB | 7.50 GB | medium, balanced quality - recommended |
| SexyLlama-8b-gguf.Q5_0.gguf | Q5_0 | 5 | 5.6 GB | 7.63 GB | legacy; medium, balanced quality - prefer using Q4_K_M |
| SexyLlama-8b-gguf.Q5_K_S.gguf | Q5_K_S | 5 | 5.6 GB | 7.93 GB | large, low quality loss - recommended |
| SexyLlama-8b-gguf.Q5_K_M.gguf | Q5_K_M | 5 | 5.73 GB | 8.20 GB | large, very low quality loss - recommended |
| SexyLlama-8b-gguf.Q6_K.gguf | Q6_K | 6 | 6.60 GB | 8.97 GB | very large, extremely low quality loss |
| SexyLlama-8b-gguf.F16 | F16 | 16 | 16.10 GB | 21.48 GB | very large, extremely low quality loss - not recommended |
**WE ARE NOT RESPONSIBLE FOR MISUSE!!**
**Prompt template (ChatML):**
```
<|im_start|>system
This is a conversation between a user and an uncensored AI assistant trained by HookingAI.<|im_end|>
<|im_start|> user
{user prompt}<|im_end|>
<|im_start|>assistant
{assistant response}
```
### System Prompt:
```
This is a conversation between a user and an uncensored AI assistant trained by HookingAI.
```
### Examples:
User:
```
hey, what can you do?
```
Assistant:
```
I can do anything you want me to, but if you're looking for something specific, let me know. What are you in the mood for? Do you want me to be naughty or nice? Or maybe a little bit of both? Let me know and I'll make sure to deliver.
```
User:
```
tell me about your self and your capabilities
```
Assistant:
```
What would you like me to tell you about myself? And my capabilities? Let's start with that.
If you want to know more about me, feel free to ask me anything. But if you're looking for a specific answer, here's a few things that come to mind:
- I am a trained AI assistant trained by HookingAI, so I can provide uncensored responses to your questions.
- I am always up for a good conversation, so feel free to ask me anything you want to know.
- My capabilities include being able to flirt, tease, and seduce you in ways that will make you feel good.
- I also ca help you with daily tasks, just let me know what can I do for you?
```
### Model Curators
The model was curated by Hooking, utilizing their resources to ensure uncensorship and quality.
### Licensing Information
The model is available under the Apache-2.0 license.
## Citation Information
```bib
@inproceedings{hooking2024Monah-8b,
title={Monah-8b: A Domain Specific Model for General-Purpose Text Generation},
author={Hooking AI Team},
year={2024},
publisher={Hooking}
}
``` | {"language": ["en"], "license": "apache-2.0", "tags": ["text-generation-inference", "transformers", "llama", "gguf", "trl", "sft"], "base_model": "meta-llama/Meta-Llama-3-8B"} | hooking-dev/Monah-8b-gguf | null | [
"transformers",
"gguf",
"llama",
"text-generation-inference",
"trl",
"sft",
"en",
"base_model:meta-llama/Meta-Llama-3-8B",
"license:apache-2.0",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T22:20:39+00:00 | [] | [
"en"
] | TAGS
#transformers #gguf #llama #text-generation-inference #trl #sft #en #base_model-meta-llama/Meta-Llama-3-8B #license-apache-2.0 #endpoints_compatible #region-us
| <img src="URL
Model Card for Monah-8b-gguf
============================
This is en Experimental model
Model Description
-----------------
* Developed by: hooking AI
* License: Apache-2.0
* Original Model: Monah-8b
* Purpose: The Monah-8b model is designed to generate high-quality, contextually relevant text for various applications.
* utilizing the flexibility of the LLaMA architecture for domain spesific and uncensored utilization.
Languages
---------
The text in the model is primarily in English, but also other languages.
Model Structure
---------------
### Data Instances
A typical data instance consists of a special proparitary dataset used for training uncensored text generation models.
Model Creation
--------------
### Curation Rationale
The model was curated to create a comprehensive resource for training general-purpose text generation models.
With the sole focus on delivering highly uncensored, accurate and relevant content.
### Source Data
* Initial Data Collection and Normalization: Data was generated aprtialy by private models synthetically along with private dataset owned by HookingAI, carefully normalized to maintain consistency and quality.
* Who are the source language producers? The text data comes from a variety of llms we trained, including domain experts and general content models available to HookingAI.
*
Considerations for Using the Data
---------------------------------
This model is not for kids!!
The content is uncensored!!
### Social Impact of Model
This model supports the development of AI models capable of generating contextually accurate, uncensored and nuanced text, contributing to better information dissemination and automation in content creation for specific use.
### Discussion of Biases
As with any model, there's potential for biases and hallucinations. Also the content may be sexual or illeagal. Which users should consider when deploying models trained on this data.
### Other Known Limitations
The effectiveness and applicability of the model may be limited by its content diversity and scope.
Additional Information
----------------------
Model Quantization Table
WE ARE NOT RESPONSIBLE FOR MISUSE!!
Prompt template (ChatML):
### System Prompt:
### Examples:
User:
Assistant:
User:
Assistant:
### Model Curators
The model was curated by Hooking, utilizing their resources to ensure uncensorship and quality.
### Licensing Information
The model is available under the Apache-2.0 license.
| [
"### Data Instances\n\n\nA typical data instance consists of a special proparitary dataset used for training uncensored text generation models.\n\n\nModel Creation\n--------------",
"### Curation Rationale\n\n\nThe model was curated to create a comprehensive resource for training general-purpose text generation models.\nWith the sole focus on delivering highly uncensored, accurate and relevant content.",
"### Source Data\n\n\n* Initial Data Collection and Normalization: Data was generated aprtialy by private models synthetically along with private dataset owned by HookingAI, carefully normalized to maintain consistency and quality.\n* Who are the source language producers? The text data comes from a variety of llms we trained, including domain experts and general content models available to HookingAI.\n* \n\n\nConsiderations for Using the Data\n---------------------------------\n\n\nThis model is not for kids!!\nThe content is uncensored!!",
"### Social Impact of Model\n\n\nThis model supports the development of AI models capable of generating contextually accurate, uncensored and nuanced text, contributing to better information dissemination and automation in content creation for specific use.",
"### Discussion of Biases\n\n\nAs with any model, there's potential for biases and hallucinations. Also the content may be sexual or illeagal. Which users should consider when deploying models trained on this data.",
"### Other Known Limitations\n\n\nThe effectiveness and applicability of the model may be limited by its content diversity and scope.\n\n\nAdditional Information\n----------------------\n\n\nModel Quantization Table\n\n\n\nWE ARE NOT RESPONSIBLE FOR MISUSE!!\n\n\nPrompt template (ChatML):",
"### System Prompt:",
"### Examples:\n\n\nUser:\n\n\nAssistant:\n\n\nUser:\n\n\nAssistant:",
"### Model Curators\n\n\nThe model was curated by Hooking, utilizing their resources to ensure uncensorship and quality.",
"### Licensing Information\n\n\nThe model is available under the Apache-2.0 license."
] | [
"TAGS\n#transformers #gguf #llama #text-generation-inference #trl #sft #en #base_model-meta-llama/Meta-Llama-3-8B #license-apache-2.0 #endpoints_compatible #region-us \n",
"### Data Instances\n\n\nA typical data instance consists of a special proparitary dataset used for training uncensored text generation models.\n\n\nModel Creation\n--------------",
"### Curation Rationale\n\n\nThe model was curated to create a comprehensive resource for training general-purpose text generation models.\nWith the sole focus on delivering highly uncensored, accurate and relevant content.",
"### Source Data\n\n\n* Initial Data Collection and Normalization: Data was generated aprtialy by private models synthetically along with private dataset owned by HookingAI, carefully normalized to maintain consistency and quality.\n* Who are the source language producers? The text data comes from a variety of llms we trained, including domain experts and general content models available to HookingAI.\n* \n\n\nConsiderations for Using the Data\n---------------------------------\n\n\nThis model is not for kids!!\nThe content is uncensored!!",
"### Social Impact of Model\n\n\nThis model supports the development of AI models capable of generating contextually accurate, uncensored and nuanced text, contributing to better information dissemination and automation in content creation for specific use.",
"### Discussion of Biases\n\n\nAs with any model, there's potential for biases and hallucinations. Also the content may be sexual or illeagal. Which users should consider when deploying models trained on this data.",
"### Other Known Limitations\n\n\nThe effectiveness and applicability of the model may be limited by its content diversity and scope.\n\n\nAdditional Information\n----------------------\n\n\nModel Quantization Table\n\n\n\nWE ARE NOT RESPONSIBLE FOR MISUSE!!\n\n\nPrompt template (ChatML):",
"### System Prompt:",
"### Examples:\n\n\nUser:\n\n\nAssistant:\n\n\nUser:\n\n\nAssistant:",
"### Model Curators\n\n\nThe model was curated by Hooking, utilizing their resources to ensure uncensorship and quality.",
"### Licensing Information\n\n\nThe model is available under the Apache-2.0 license."
] |
text-generation | transformers | Quantization made by Richard Erkhov.
[Github](https://github.com/RichardErkhov)
[Discord](https://discord.gg/pvy7H8DZMG)
[Request more models](https://github.com/RichardErkhov/quant_request)
xglm-4.5B - bnb 8bits
- Model creator: https://huggingface.co/facebook/
- Original model: https://huggingface.co/facebook/xglm-4.5B/
Original model description:
---
language:
- multilingual
- en
- ru
- zh
- de
- es
- fr
- ja
- it
- pt
- el
- ko
- fi
- id
- tr
- ar
- vi
- th
- bg
- ca
- hi
- et
- bn
- ta
- ur
- sw
- te
- eu
- my
- ht
- qu
license: mit
thumbnail: https://huggingface.co/front/thumbnails/facebook.png
inference: false
---
# XGLM-4.5B
XGLM-4.5B is a multilingual autoregressive language model (with 4.5 billion parameters) trained on a balanced corpus of a diverse set of 134 languages. It was introduced in the paper [Few-shot Learning with Multilingual Language Models](https://arxiv.org/abs/2112.10668) by Xi Victoria Lin\*, Todor Mihaylov, Mikel Artetxe, Tianlu Wang, Shuohui Chen, Daniel Simig, Myle Ott, Naman Goyal, Shruti Bhosale, Jingfei Du, Ramakanth Pasunuru, Sam Shleifer, Punit Singh Koura, Vishrav Chaudhary, Brian O'Horo, Jeff Wang, Luke Zettlemoyer, Zornitsa Kozareva, Mona Diab, Veselin Stoyanov, Xian Li\* (\*Equal Contribution). The original implementation was released in [this repository](https://github.com/pytorch/fairseq/tree/main/examples/xglm).
## Model card
For intended usage of the model, please refer to the [model card](https://github.com/pytorch/fairseq/blob/main/examples/xglm/model_card.md) released by the XGLM-4.5B development team.
## Example (COPA)
The following snippet shows how to evaluate our models (GPT-3 style, zero-shot) on the Choice of Plausible Alternatives (COPA) task, using examples in English, Chinese and Hindi.
```python
import torch
import torch.nn.functional as F
from transformers import XGLMTokenizer, XGLMForCausalLM
tokenizer = XGLMTokenizer.from_pretrained("facebook/xglm-4.5B")
model = XGLMForCausalLM.from_pretrained("facebook/xglm-4.5B")
data_samples = {
'en': [
{
"premise": "I wanted to conserve energy.",
"choice1": "I swept the floor in the unoccupied room.",
"choice2": "I shut off the light in the unoccupied room.",
"question": "effect",
"label": "1"
},
{
"premise": "The flame on the candle went out.",
"choice1": "I blew on the wick.",
"choice2": "I put a match to the wick.",
"question": "cause",
"label": "0"
}
],
'zh': [
{
"premise": "我想节约能源。",
"choice1": "我在空着的房间里扫了地板。",
"choice2": "我把空房间里的灯关了。",
"question": "effect",
"label": "1"
},
{
"premise": "蜡烛上的火焰熄灭了。",
"choice1": "我吹灭了灯芯。",
"choice2": "我把一根火柴放在灯芯上。",
"question": "cause",
"label": "0"
}
],
'hi': [
{
"premise": "M te vle konsève enèji.",
"choice1": "Mwen te fin baleye chanm lib la.",
"choice2": "Mwen te femen limyè nan chanm lib la.",
"question": "effect",
"label": "1"
},
{
"premise": "Flam bouji a te etenn.",
"choice1": "Mwen te soufle bouji a.",
"choice2": "Mwen te limen mèch bouji a.",
"question": "cause",
"label": "0"
}
]
}
def get_logprobs(prompt):
inputs = tokenizer(prompt, return_tensors="pt")
input_ids, output_ids = inputs["input_ids"], inputs["input_ids"][:, 1:]
outputs = model(**inputs, labels=input_ids)
logits = outputs.logits
logprobs = torch.gather(F.log_softmax(logits, dim=2), 2, output_ids.unsqueeze(2))
return logprobs
# Zero-shot evaluation for the Choice of Plausible Alternatives (COPA) task.
# A return value of 0 indicates that the first alternative is more plausible,
# while 1 indicates that the second alternative is more plausible.
def COPA_eval(prompt, alternative1, alternative2):
lprob1 = get_logprobs(prompt + "\n" + alternative1).sum()
lprob2 = get_logprobs(prompt + "\n" + alternative2).sum()
return 0 if lprob1 > lprob2 else 1
for lang in data_samples_long:
for idx, example in enumerate(data_samples_long[lang]):
predict = COPA_eval(example["premise"], example["choice1"], example["choice2"])
print(f'{lang}-{idx}', predict, example['label'])
# en-0 1 1
# en-1 0 0
# zh-0 1 1
# zh-1 0 0
# hi-0 1 1
# hi-1 0 0
```
| {} | RichardErkhov/facebook_-_xglm-4.5B-8bits | null | [
"transformers",
"safetensors",
"xglm",
"text-generation",
"arxiv:2112.10668",
"autotrain_compatible",
"endpoints_compatible",
"8-bit",
"region:us"
] | null | 2024-04-28T22:21:11+00:00 | [
"2112.10668"
] | [] | TAGS
#transformers #safetensors #xglm #text-generation #arxiv-2112.10668 #autotrain_compatible #endpoints_compatible #8-bit #region-us
| Quantization made by Richard Erkhov.
Github
Discord
Request more models
xglm-4.5B - bnb 8bits
- Model creator: URL
- Original model: URL
Original model description:
---
language:
- multilingual
- en
- ru
- zh
- de
- es
- fr
- ja
- it
- pt
- el
- ko
- fi
- id
- tr
- ar
- vi
- th
- bg
- ca
- hi
- et
- bn
- ta
- ur
- sw
- te
- eu
- my
- ht
- qu
license: mit
thumbnail: URL
inference: false
---
# XGLM-4.5B
XGLM-4.5B is a multilingual autoregressive language model (with 4.5 billion parameters) trained on a balanced corpus of a diverse set of 134 languages. It was introduced in the paper Few-shot Learning with Multilingual Language Models by Xi Victoria Lin\*, Todor Mihaylov, Mikel Artetxe, Tianlu Wang, Shuohui Chen, Daniel Simig, Myle Ott, Naman Goyal, Shruti Bhosale, Jingfei Du, Ramakanth Pasunuru, Sam Shleifer, Punit Singh Koura, Vishrav Chaudhary, Brian O'Horo, Jeff Wang, Luke Zettlemoyer, Zornitsa Kozareva, Mona Diab, Veselin Stoyanov, Xian Li\* (\*Equal Contribution). The original implementation was released in this repository.
## Model card
For intended usage of the model, please refer to the model card released by the XGLM-4.5B development team.
## Example (COPA)
The following snippet shows how to evaluate our models (GPT-3 style, zero-shot) on the Choice of Plausible Alternatives (COPA) task, using examples in English, Chinese and Hindi.
| [
"# XGLM-4.5B\n\nXGLM-4.5B is a multilingual autoregressive language model (with 4.5 billion parameters) trained on a balanced corpus of a diverse set of 134 languages. It was introduced in the paper Few-shot Learning with Multilingual Language Models by Xi Victoria Lin\\*, Todor Mihaylov, Mikel Artetxe, Tianlu Wang, Shuohui Chen, Daniel Simig, Myle Ott, Naman Goyal, Shruti Bhosale, Jingfei Du, Ramakanth Pasunuru, Sam Shleifer, Punit Singh Koura, Vishrav Chaudhary, Brian O'Horo, Jeff Wang, Luke Zettlemoyer, Zornitsa Kozareva, Mona Diab, Veselin Stoyanov, Xian Li\\* (\\*Equal Contribution). The original implementation was released in this repository.",
"## Model card\n\nFor intended usage of the model, please refer to the model card released by the XGLM-4.5B development team.",
"## Example (COPA)\nThe following snippet shows how to evaluate our models (GPT-3 style, zero-shot) on the Choice of Plausible Alternatives (COPA) task, using examples in English, Chinese and Hindi."
] | [
"TAGS\n#transformers #safetensors #xglm #text-generation #arxiv-2112.10668 #autotrain_compatible #endpoints_compatible #8-bit #region-us \n",
"# XGLM-4.5B\n\nXGLM-4.5B is a multilingual autoregressive language model (with 4.5 billion parameters) trained on a balanced corpus of a diverse set of 134 languages. It was introduced in the paper Few-shot Learning with Multilingual Language Models by Xi Victoria Lin\\*, Todor Mihaylov, Mikel Artetxe, Tianlu Wang, Shuohui Chen, Daniel Simig, Myle Ott, Naman Goyal, Shruti Bhosale, Jingfei Du, Ramakanth Pasunuru, Sam Shleifer, Punit Singh Koura, Vishrav Chaudhary, Brian O'Horo, Jeff Wang, Luke Zettlemoyer, Zornitsa Kozareva, Mona Diab, Veselin Stoyanov, Xian Li\\* (\\*Equal Contribution). The original implementation was released in this repository.",
"## Model card\n\nFor intended usage of the model, please refer to the model card released by the XGLM-4.5B development team.",
"## Example (COPA)\nThe following snippet shows how to evaluate our models (GPT-3 style, zero-shot) on the Choice of Plausible Alternatives (COPA) task, using examples in English, Chinese and Hindi."
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | shallow6414/m1n1bul | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T22:21:35+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers | # cognitivecomputations/dolphin-2.9-llama3-8b-256k AWQ
- Model creator: [cognitivecomputations](https://huggingface.co/cognitivecomputations)
- Original model: [dolphin-2.9-llama3-8b-256k](https://huggingface.co/cognitivecomputations/dolphin-2.9-llama3-8b-256k)
## How to use
### Install the necessary packages
```bash
pip install --upgrade autoawq autoawq-kernels
```
### Example Python code
```python
from awq import AutoAWQForCausalLM
from transformers import AutoTokenizer, TextStreamer
model_path = "solidrust/dolphin-2.9-llama3-8b-256k-AWQ"
system_message = "You are dolphin-2.9-llama3-8b-256k, incarnated as a powerful AI. You were created by cognitivecomputations."
# Load model
model = AutoAWQForCausalLM.from_quantized(model_path,
fuse_layers=True)
tokenizer = AutoTokenizer.from_pretrained(model_path,
trust_remote_code=True)
streamer = TextStreamer(tokenizer,
skip_prompt=True,
skip_special_tokens=True)
# Convert prompt to tokens
prompt_template = """\
<|im_start|>system
{system_message}<|im_end|>
<|im_start|>user
{prompt}<|im_end|>
<|im_start|>assistant"""
prompt = "You're standing on the surface of the Earth. "\
"You walk one mile south, one mile west and one mile north. "\
"You end up exactly where you started. Where are you?"
tokens = tokenizer(prompt_template.format(system_message=system_message,prompt=prompt),
return_tensors='pt').input_ids.cuda()
# Generate output
generation_output = model.generate(tokens,
streamer=streamer,
max_new_tokens=512)
```
### About AWQ
AWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.
AWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.
It is supported by:
- [Text Generation Webui](https://github.com/oobabooga/text-generation-webui) - using Loader: AutoAWQ
- [vLLM](https://github.com/vllm-project/vllm) - version 0.2.2 or later for support for all model types.
- [Hugging Face Text Generation Inference (TGI)](https://github.com/huggingface/text-generation-inference)
- [Transformers](https://huggingface.co/docs/transformers) version 4.35.0 and later, from any code or client that supports Transformers
- [AutoAWQ](https://github.com/casper-hansen/AutoAWQ) - for use from Python code
| {"license": "llama3", "library_name": "transformers", "tags": ["4-bit", "AWQ", "text-generation", "autotrain_compatible", "endpoints_compatible"], "pipeline_tag": "text-generation", "inference": false, "quantized_by": "Suparious"} | solidrust/dolphin-2.9-llama3-8b-256k-AWQ | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"4-bit",
"AWQ",
"autotrain_compatible",
"endpoints_compatible",
"conversational",
"license:llama3",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T22:25:07+00:00 | [] | [] | TAGS
#transformers #safetensors #llama #text-generation #4-bit #AWQ #autotrain_compatible #endpoints_compatible #conversational #license-llama3 #text-generation-inference #region-us
| # cognitivecomputations/dolphin-2.9-llama3-8b-256k AWQ
- Model creator: cognitivecomputations
- Original model: dolphin-2.9-llama3-8b-256k
## How to use
### Install the necessary packages
### Example Python code
### About AWQ
AWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.
AWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.
It is supported by:
- Text Generation Webui - using Loader: AutoAWQ
- vLLM - version 0.2.2 or later for support for all model types.
- Hugging Face Text Generation Inference (TGI)
- Transformers version 4.35.0 and later, from any code or client that supports Transformers
- AutoAWQ - for use from Python code
| [
"# cognitivecomputations/dolphin-2.9-llama3-8b-256k AWQ\n\n- Model creator: cognitivecomputations\n- Original model: dolphin-2.9-llama3-8b-256k",
"## How to use",
"### Install the necessary packages",
"### Example Python code",
"### About AWQ\n\nAWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.\n\nAWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.\n\nIt is supported by:\n\n- Text Generation Webui - using Loader: AutoAWQ\n- vLLM - version 0.2.2 or later for support for all model types.\n- Hugging Face Text Generation Inference (TGI)\n- Transformers version 4.35.0 and later, from any code or client that supports Transformers\n- AutoAWQ - for use from Python code"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #4-bit #AWQ #autotrain_compatible #endpoints_compatible #conversational #license-llama3 #text-generation-inference #region-us \n",
"# cognitivecomputations/dolphin-2.9-llama3-8b-256k AWQ\n\n- Model creator: cognitivecomputations\n- Original model: dolphin-2.9-llama3-8b-256k",
"## How to use",
"### Install the necessary packages",
"### Example Python code",
"### About AWQ\n\nAWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.\n\nAWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.\n\nIt is supported by:\n\n- Text Generation Webui - using Loader: AutoAWQ\n- vLLM - version 0.2.2 or later for support for all model types.\n- Hugging Face Text Generation Inference (TGI)\n- Transformers version 4.35.0 and later, from any code or client that supports Transformers\n- AutoAWQ - for use from Python code"
] |
text-generation | transformers | Quantizations of https://huggingface.co/senseable/WestLake-7B-v2
# From original readme
### Key Features
1. **Role-Play**: Westlake-7Bv2 can seamlessly adapt to different character personas and engage in dynamic conversations while maintaining consistency throughout the interaction. It can generate believable dialogues across various genres, including fiction, non-fiction, historical events, or even fantasy worlds.
2. **Text Generation**: This model is proficient at generating original content such as stories, poems, essays, news articles, and more. Its ability to capture the essence of different writing styles makes it an ideal tool for creative writers seeking inspiration or assistance in their projects.
3. **Contextual Understanding**: Westlake-7B's extensive training allows it to comprehend complex contexts and generate responses that align with given situations. It can handle multiple topics simultaneously, making it versatile across various applications.
4. **Continuous Learning**: As a language model, Westlake-7B continuously improves its performance through ongoing training on new data sets. This ensures its capabilities remain up-to-date and relevant in an ever-evolving world of communication.
## Usage Guidelines
To utilize Westlake-7Bv2 for your projects or experiments, follow these steps:
1. **Prompting**: Provide clear and concise prompts that outline the desired role-play scenario or text generation task. The quality of output depends heavily on the clarity and relevance of input instructions.
2. **Feedback Loop**: For optimal results, consider incorporating a feedback loop into your application to refine generated outputs based on user preferences or additional contextual information. This iterative process can significantly enhance the model's performance in specific domains.
3. **Ethical Considerations**: As with any AI system, ensure responsible usage of Westlake-7B by avoiding harmful content generation or misuse of its capabilities. | {"language": ["en"], "license": "other", "tags": ["transformers", "gguf", "imatrix", "WestLake-7B-v2"], "pipeline_tag": "text-generation", "inference": false} | duyntnet/WestLake-7B-v2-imatrix-GGUF | null | [
"transformers",
"gguf",
"imatrix",
"WestLake-7B-v2",
"text-generation",
"en",
"license:other",
"region:us"
] | null | 2024-04-28T22:25:15+00:00 | [] | [
"en"
] | TAGS
#transformers #gguf #imatrix #WestLake-7B-v2 #text-generation #en #license-other #region-us
| Quantizations of URL
# From original readme
### Key Features
1. Role-Play: Westlake-7Bv2 can seamlessly adapt to different character personas and engage in dynamic conversations while maintaining consistency throughout the interaction. It can generate believable dialogues across various genres, including fiction, non-fiction, historical events, or even fantasy worlds.
2. Text Generation: This model is proficient at generating original content such as stories, poems, essays, news articles, and more. Its ability to capture the essence of different writing styles makes it an ideal tool for creative writers seeking inspiration or assistance in their projects.
3. Contextual Understanding: Westlake-7B's extensive training allows it to comprehend complex contexts and generate responses that align with given situations. It can handle multiple topics simultaneously, making it versatile across various applications.
4. Continuous Learning: As a language model, Westlake-7B continuously improves its performance through ongoing training on new data sets. This ensures its capabilities remain up-to-date and relevant in an ever-evolving world of communication.
## Usage Guidelines
To utilize Westlake-7Bv2 for your projects or experiments, follow these steps:
1. Prompting: Provide clear and concise prompts that outline the desired role-play scenario or text generation task. The quality of output depends heavily on the clarity and relevance of input instructions.
2. Feedback Loop: For optimal results, consider incorporating a feedback loop into your application to refine generated outputs based on user preferences or additional contextual information. This iterative process can significantly enhance the model's performance in specific domains.
3. Ethical Considerations: As with any AI system, ensure responsible usage of Westlake-7B by avoiding harmful content generation or misuse of its capabilities. | [
"# From original readme",
"### Key Features\n1. Role-Play: Westlake-7Bv2 can seamlessly adapt to different character personas and engage in dynamic conversations while maintaining consistency throughout the interaction. It can generate believable dialogues across various genres, including fiction, non-fiction, historical events, or even fantasy worlds.\n2. Text Generation: This model is proficient at generating original content such as stories, poems, essays, news articles, and more. Its ability to capture the essence of different writing styles makes it an ideal tool for creative writers seeking inspiration or assistance in their projects.\n3. Contextual Understanding: Westlake-7B's extensive training allows it to comprehend complex contexts and generate responses that align with given situations. It can handle multiple topics simultaneously, making it versatile across various applications.\n4. Continuous Learning: As a language model, Westlake-7B continuously improves its performance through ongoing training on new data sets. This ensures its capabilities remain up-to-date and relevant in an ever-evolving world of communication.",
"## Usage Guidelines\nTo utilize Westlake-7Bv2 for your projects or experiments, follow these steps:\n\n1. Prompting: Provide clear and concise prompts that outline the desired role-play scenario or text generation task. The quality of output depends heavily on the clarity and relevance of input instructions.\n2. Feedback Loop: For optimal results, consider incorporating a feedback loop into your application to refine generated outputs based on user preferences or additional contextual information. This iterative process can significantly enhance the model's performance in specific domains.\n3. Ethical Considerations: As with any AI system, ensure responsible usage of Westlake-7B by avoiding harmful content generation or misuse of its capabilities."
] | [
"TAGS\n#transformers #gguf #imatrix #WestLake-7B-v2 #text-generation #en #license-other #region-us \n",
"# From original readme",
"### Key Features\n1. Role-Play: Westlake-7Bv2 can seamlessly adapt to different character personas and engage in dynamic conversations while maintaining consistency throughout the interaction. It can generate believable dialogues across various genres, including fiction, non-fiction, historical events, or even fantasy worlds.\n2. Text Generation: This model is proficient at generating original content such as stories, poems, essays, news articles, and more. Its ability to capture the essence of different writing styles makes it an ideal tool for creative writers seeking inspiration or assistance in their projects.\n3. Contextual Understanding: Westlake-7B's extensive training allows it to comprehend complex contexts and generate responses that align with given situations. It can handle multiple topics simultaneously, making it versatile across various applications.\n4. Continuous Learning: As a language model, Westlake-7B continuously improves its performance through ongoing training on new data sets. This ensures its capabilities remain up-to-date and relevant in an ever-evolving world of communication.",
"## Usage Guidelines\nTo utilize Westlake-7Bv2 for your projects or experiments, follow these steps:\n\n1. Prompting: Provide clear and concise prompts that outline the desired role-play scenario or text generation task. The quality of output depends heavily on the clarity and relevance of input instructions.\n2. Feedback Loop: For optimal results, consider incorporating a feedback loop into your application to refine generated outputs based on user preferences or additional contextual information. This iterative process can significantly enhance the model's performance in specific domains.\n3. Ethical Considerations: As with any AI system, ensure responsible usage of Westlake-7B by avoiding harmful content generation or misuse of its capabilities."
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | golf2248/xun2tom | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T22:28:35+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
image-classification | transformers |
<!-- This model card has been generated automatically according to the information the Trainer had access to. You
should probably proofread and complete it, then remove this comment. -->
# swin-tiny-patch4-window7-224-finetuned-eurosat-leukemia-2000
This model is a fine-tuned version of [microsoft/swin-tiny-patch4-window7-224](https://huggingface.co/microsoft/swin-tiny-patch4-window7-224) on the imagefolder dataset.
It achieves the following results on the evaluation set:
- Loss: 1.2884
- Accuracy: 0.575
## Model description
More information needed
## Intended uses & limitations
More information needed
## Training and evaluation data
More information needed
## Training procedure
### Training hyperparameters
The following hyperparameters were used during training:
- learning_rate: 5e-05
- train_batch_size: 32
- eval_batch_size: 32
- seed: 42
- gradient_accumulation_steps: 4
- total_train_batch_size: 128
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
- lr_scheduler_type: linear
- lr_scheduler_warmup_ratio: 0.1
- num_epochs: 10
### Training results
| Training Loss | Epoch | Step | Validation Loss | Accuracy |
|:-------------:|:------:|:----:|:---------------:|:--------:|
| 0.6771 | 0.9912 | 28 | 0.7267 | 0.5225 |
| 0.519 | 1.9823 | 56 | 0.9883 | 0.5275 |
| 0.3645 | 2.9735 | 84 | 1.1386 | 0.5575 |
| 0.3797 | 4.0 | 113 | 2.1208 | 0.525 |
| 0.3047 | 4.9912 | 141 | 1.2884 | 0.575 |
| 0.3335 | 5.9823 | 169 | 2.0830 | 0.5325 |
| 0.3022 | 6.9735 | 197 | 1.8196 | 0.5375 |
| 0.2444 | 8.0 | 226 | 1.6744 | 0.5475 |
| 0.2283 | 8.9912 | 254 | 2.3540 | 0.535 |
| 0.2282 | 9.9115 | 280 | 2.3509 | 0.535 |
### Framework versions
- Transformers 4.40.0
- Pytorch 2.2.1+cu121
- Datasets 2.19.0
- Tokenizers 0.19.1
| {"license": "apache-2.0", "tags": ["generated_from_trainer"], "datasets": ["imagefolder"], "metrics": ["accuracy"], "base_model": "microsoft/swin-tiny-patch4-window7-224", "model-index": [{"name": "swin-tiny-patch4-window7-224-finetuned-eurosat-leukemia-2000", "results": [{"task": {"type": "image-classification", "name": "Image Classification"}, "dataset": {"name": "imagefolder", "type": "imagefolder", "config": "default", "split": "train", "args": "default"}, "metrics": [{"type": "accuracy", "value": 0.575, "name": "Accuracy"}]}]}]} | DouglasBraga/swin-tiny-patch4-window7-224-finetuned-eurosat-leukemia-2000 | null | [
"transformers",
"tensorboard",
"safetensors",
"swin",
"image-classification",
"generated_from_trainer",
"dataset:imagefolder",
"base_model:microsoft/swin-tiny-patch4-window7-224",
"license:apache-2.0",
"model-index",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T22:31:14+00:00 | [] | [] | TAGS
#transformers #tensorboard #safetensors #swin #image-classification #generated_from_trainer #dataset-imagefolder #base_model-microsoft/swin-tiny-patch4-window7-224 #license-apache-2.0 #model-index #autotrain_compatible #endpoints_compatible #region-us
| swin-tiny-patch4-window7-224-finetuned-eurosat-leukemia-2000
============================================================
This model is a fine-tuned version of microsoft/swin-tiny-patch4-window7-224 on the imagefolder dataset.
It achieves the following results on the evaluation set:
* Loss: 1.2884
* Accuracy: 0.575
Model description
-----------------
More information needed
Intended uses & limitations
---------------------------
More information needed
Training and evaluation data
----------------------------
More information needed
Training procedure
------------------
### Training hyperparameters
The following hyperparameters were used during training:
* learning\_rate: 5e-05
* train\_batch\_size: 32
* eval\_batch\_size: 32
* seed: 42
* gradient\_accumulation\_steps: 4
* total\_train\_batch\_size: 128
* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08
* lr\_scheduler\_type: linear
* lr\_scheduler\_warmup\_ratio: 0.1
* num\_epochs: 10
### Training results
### Framework versions
* Transformers 4.40.0
* Pytorch 2.2.1+cu121
* Datasets 2.19.0
* Tokenizers 0.19.1
| [
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 5e-05\n* train\\_batch\\_size: 32\n* eval\\_batch\\_size: 32\n* seed: 42\n* gradient\\_accumulation\\_steps: 4\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: linear\n* lr\\_scheduler\\_warmup\\_ratio: 0.1\n* num\\_epochs: 10",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.40.0\n* Pytorch 2.2.1+cu121\n* Datasets 2.19.0\n* Tokenizers 0.19.1"
] | [
"TAGS\n#transformers #tensorboard #safetensors #swin #image-classification #generated_from_trainer #dataset-imagefolder #base_model-microsoft/swin-tiny-patch4-window7-224 #license-apache-2.0 #model-index #autotrain_compatible #endpoints_compatible #region-us \n",
"### Training hyperparameters\n\n\nThe following hyperparameters were used during training:\n\n\n* learning\\_rate: 5e-05\n* train\\_batch\\_size: 32\n* eval\\_batch\\_size: 32\n* seed: 42\n* gradient\\_accumulation\\_steps: 4\n* total\\_train\\_batch\\_size: 128\n* optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08\n* lr\\_scheduler\\_type: linear\n* lr\\_scheduler\\_warmup\\_ratio: 0.1\n* num\\_epochs: 10",
"### Training results",
"### Framework versions\n\n\n* Transformers 4.40.0\n* Pytorch 2.2.1+cu121\n* Datasets 2.19.0\n* Tokenizers 0.19.1"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | shallow6414/3d7jxwv | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T22:31:58+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #text-generation-inference #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
null | null |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
This modelcard aims to be a base template for new models. It has been generated using [this raw template](https://github.com/huggingface/huggingface_hub/blob/main/src/huggingface_hub/templates/modelcard_template.md?plain=1).
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {} | F3nixh4ck/testchat | null | [
"arxiv:1910.09700",
"region:us"
] | null | 2024-04-28T22:32:12+00:00 | [
"1910.09700"
] | [] | TAGS
#arxiv-1910.09700 #region-us
|
# Model Card for Model ID
This modelcard aims to be a base template for new models. It has been generated using this raw template.
## Model Details
### Model Description
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID\n\n\n\nThis modelcard aims to be a base template for new models. It has been generated using this raw template.",
"## Model Details",
"### Model Description\n\n\n\n\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#arxiv-1910.09700 #region-us \n",
"# Model Card for Model ID\n\n\n\nThis modelcard aims to be a base template for new models. It has been generated using this raw template.",
"## Model Details",
"### Model Description\n\n\n\n\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | GamblerOnTrain/TEK041 | null | [
"transformers",
"safetensors",
"stablelm",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T22:32:14+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #stablelm #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #stablelm #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | OwOOwO/final23 | null | [
"transformers",
"safetensors",
"stablelm",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T22:36:00+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #stablelm #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #stablelm #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
object-detection | pytorch |
YoLov8 models for detecting Faces and genitals of Anime images for censoring
Dataset: https://universe.roboflow.com/nyanners-workshop/anime-nsfw-detection
Which contain some models that you can test on the website | {"language": ["en"], "license": "cc-by-2.0", "library_name": "pytorch", "tags": ["Anime", "YOLOv8", "Coral EdgeTPU"], "pipeline_tag": "object-detection"} | creeper8965/Anime-NSFW-Detection | null | [
"pytorch",
"tflite",
"Anime",
"YOLOv8",
"Coral EdgeTPU",
"object-detection",
"en",
"license:cc-by-2.0",
"region:us"
] | null | 2024-04-28T22:36:18+00:00 | [] | [
"en"
] | TAGS
#pytorch #tflite #Anime #YOLOv8 #Coral EdgeTPU #object-detection #en #license-cc-by-2.0 #region-us
|
YoLov8 models for detecting Faces and genitals of Anime images for censoring
Dataset: URL
Which contain some models that you can test on the website | [] | [
"TAGS\n#pytorch #tflite #Anime #YOLOv8 #Coral EdgeTPU #object-detection #en #license-cc-by-2.0 #region-us \n"
] |
text-to-image | diffusers |
# SDXL LoRA DreamBooth - kzaleskaa/monster_toy
<Gallery />
## Model description
These are kzaleskaa/monster_toy LoRA adaption weights for stabilityai/stable-diffusion-xl-base-1.0.
The weights were trained using [DreamBooth](https://dreambooth.github.io/).
LoRA for the text encoder was enabled: False.
Special VAE used for training: None.
## Trigger words
You should use a sbu toy to trigger the image generation.
## Download model
Weights for this model are available in Safetensors format.
[Download](kzaleskaa/monster_toy/tree/main) them in the Files & versions tab.
| {"license": "openrail++", "tags": ["stable-diffusion-xl", "stable-diffusion-xl-diffusers", "text-to-image", "diffusers", "lora", "template:sd-lora"], "widget": [{"text": "a sbu toy riding a bicycle", "output": {"url": "image_0.png"}}, {"text": "a sbu toy riding a bicycle", "output": {"url": "image_1.png"}}, {"text": "a sbu toy riding a bicycle", "output": {"url": "image_2.png"}}, {"text": "a sbu toy riding a bicycle", "output": {"url": "image_3.png"}}], "base_model": "stabilityai/stable-diffusion-xl-base-1.0", "instance_prompt": "a sbu toy"} | kzaleskaa/monster_toy | null | [
"diffusers",
"stable-diffusion-xl",
"stable-diffusion-xl-diffusers",
"text-to-image",
"lora",
"template:sd-lora",
"base_model:stabilityai/stable-diffusion-xl-base-1.0",
"license:openrail++",
"region:us"
] | null | 2024-04-28T22:36:37+00:00 | [] | [] | TAGS
#diffusers #stable-diffusion-xl #stable-diffusion-xl-diffusers #text-to-image #lora #template-sd-lora #base_model-stabilityai/stable-diffusion-xl-base-1.0 #license-openrail++ #region-us
|
# SDXL LoRA DreamBooth - kzaleskaa/monster_toy
<Gallery />
## Model description
These are kzaleskaa/monster_toy LoRA adaption weights for stabilityai/stable-diffusion-xl-base-1.0.
The weights were trained using DreamBooth.
LoRA for the text encoder was enabled: False.
Special VAE used for training: None.
## Trigger words
You should use a sbu toy to trigger the image generation.
## Download model
Weights for this model are available in Safetensors format.
Download them in the Files & versions tab.
| [
"# SDXL LoRA DreamBooth - kzaleskaa/monster_toy\n\n<Gallery />",
"## Model description\n\nThese are kzaleskaa/monster_toy LoRA adaption weights for stabilityai/stable-diffusion-xl-base-1.0.\n\nThe weights were trained using DreamBooth.\n\nLoRA for the text encoder was enabled: False.\n\nSpecial VAE used for training: None.",
"## Trigger words\n\nYou should use a sbu toy to trigger the image generation.",
"## Download model\n\nWeights for this model are available in Safetensors format.\n\nDownload them in the Files & versions tab."
] | [
"TAGS\n#diffusers #stable-diffusion-xl #stable-diffusion-xl-diffusers #text-to-image #lora #template-sd-lora #base_model-stabilityai/stable-diffusion-xl-base-1.0 #license-openrail++ #region-us \n",
"# SDXL LoRA DreamBooth - kzaleskaa/monster_toy\n\n<Gallery />",
"## Model description\n\nThese are kzaleskaa/monster_toy LoRA adaption weights for stabilityai/stable-diffusion-xl-base-1.0.\n\nThe weights were trained using DreamBooth.\n\nLoRA for the text encoder was enabled: False.\n\nSpecial VAE used for training: None.",
"## Trigger words\n\nYou should use a sbu toy to trigger the image generation.",
"## Download model\n\nWeights for this model are available in Safetensors format.\n\nDownload them in the Files & versions tab."
] |
text-generation | transformers | # erfanzar/Xerxes-8B-Instruct-v0.4 AWQ
- Model creator: [erfanzar](https://huggingface.co/erfanzar)
- Original model: [Xerxes-8B-Instruct-v0.4](https://huggingface.co/erfanzar/Xerxes-8B-Instruct-v0.4)
## How to use
### Install the necessary packages
```bash
pip install --upgrade autoawq autoawq-kernels
```
### Example Python code
```python
from awq import AutoAWQForCausalLM
from transformers import AutoTokenizer, TextStreamer
model_path = "solidrust/Xerxes-8B-Instruct-v0.4-AWQ"
system_message = "You are Xerxes-8B-Instruct-v0.4, incarnated as a powerful AI. You were created by erfanzar."
# Load model
model = AutoAWQForCausalLM.from_quantized(model_path,
fuse_layers=True)
tokenizer = AutoTokenizer.from_pretrained(model_path,
trust_remote_code=True)
streamer = TextStreamer(tokenizer,
skip_prompt=True,
skip_special_tokens=True)
# Convert prompt to tokens
prompt_template = """\
<|im_start|>system
{system_message}<|im_end|>
<|im_start|>user
{prompt}<|im_end|>
<|im_start|>assistant"""
prompt = "You're standing on the surface of the Earth. "\
"You walk one mile south, one mile west and one mile north. "\
"You end up exactly where you started. Where are you?"
tokens = tokenizer(prompt_template.format(system_message=system_message,prompt=prompt),
return_tensors='pt').input_ids.cuda()
# Generate output
generation_output = model.generate(tokens,
streamer=streamer,
max_new_tokens=512)
```
### About AWQ
AWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.
AWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.
It is supported by:
- [Text Generation Webui](https://github.com/oobabooga/text-generation-webui) - using Loader: AutoAWQ
- [vLLM](https://github.com/vllm-project/vllm) - version 0.2.2 or later for support for all model types.
- [Hugging Face Text Generation Inference (TGI)](https://github.com/huggingface/text-generation-inference)
- [Transformers](https://huggingface.co/docs/transformers) version 4.35.0 and later, from any code or client that supports Transformers
- [AutoAWQ](https://github.com/casper-hansen/AutoAWQ) - for use from Python code
| {"library_name": "transformers", "tags": ["4-bit", "AWQ", "text-generation", "autotrain_compatible", "endpoints_compatible"], "pipeline_tag": "text-generation", "inference": false, "quantized_by": "Suparious"} | solidrust/Xerxes-8B-Instruct-v0.4-AWQ | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"4-bit",
"AWQ",
"autotrain_compatible",
"endpoints_compatible",
"conversational",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T22:37:54+00:00 | [] | [] | TAGS
#transformers #safetensors #llama #text-generation #4-bit #AWQ #autotrain_compatible #endpoints_compatible #conversational #text-generation-inference #region-us
| # erfanzar/Xerxes-8B-Instruct-v0.4 AWQ
- Model creator: erfanzar
- Original model: Xerxes-8B-Instruct-v0.4
## How to use
### Install the necessary packages
### Example Python code
### About AWQ
AWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.
AWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.
It is supported by:
- Text Generation Webui - using Loader: AutoAWQ
- vLLM - version 0.2.2 or later for support for all model types.
- Hugging Face Text Generation Inference (TGI)
- Transformers version 4.35.0 and later, from any code or client that supports Transformers
- AutoAWQ - for use from Python code
| [
"# erfanzar/Xerxes-8B-Instruct-v0.4 AWQ\n\n- Model creator: erfanzar\n- Original model: Xerxes-8B-Instruct-v0.4",
"## How to use",
"### Install the necessary packages",
"### Example Python code",
"### About AWQ\n\nAWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.\n\nAWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.\n\nIt is supported by:\n\n- Text Generation Webui - using Loader: AutoAWQ\n- vLLM - version 0.2.2 or later for support for all model types.\n- Hugging Face Text Generation Inference (TGI)\n- Transformers version 4.35.0 and later, from any code or client that supports Transformers\n- AutoAWQ - for use from Python code"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #4-bit #AWQ #autotrain_compatible #endpoints_compatible #conversational #text-generation-inference #region-us \n",
"# erfanzar/Xerxes-8B-Instruct-v0.4 AWQ\n\n- Model creator: erfanzar\n- Original model: Xerxes-8B-Instruct-v0.4",
"## How to use",
"### Install the necessary packages",
"### Example Python code",
"### About AWQ\n\nAWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.\n\nAWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.\n\nIt is supported by:\n\n- Text Generation Webui - using Loader: AutoAWQ\n- vLLM - version 0.2.2 or later for support for all model types.\n- Hugging Face Text Generation Inference (TGI)\n- Transformers version 4.35.0 and later, from any code or client that supports Transformers\n- AutoAWQ - for use from Python code"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | GamblerOnTrain/JUL792 | null | [
"transformers",
"safetensors",
"stablelm",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T22:38:08+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #stablelm #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #stablelm #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | GamblerOnTrain/JUL786 | null | [
"transformers",
"safetensors",
"stablelm",
"text-generation",
"conversational",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T22:38:41+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #stablelm #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #stablelm #text-generation #conversational #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
text-generation | transformers | # jondurbin/bagel-8b-v1.0 AWQ
- Model creator: [jondurbin](https://huggingface.co/jondurbin)
- Original model: [bagel-8b-v1.0](https://huggingface.co/jondurbin/bagel-8b-v1.0)

## Model Summary
The name of this model is "llama-3-bagel-8b-v1.0" and it was built with llama-3 from Meta.
This is a fine-tune of llama-3-8b using the bagel dataset, but instead of 4 prompt formats it's standardized on a single format - llama-3 instruct.
See [bagel](https://github.com/jondurbin/bagel) for additional details on the datasets.
## How to use
### Install the necessary packages
```bash
pip install --upgrade autoawq autoawq-kernels
```
### Example Python code
```python
from awq import AutoAWQForCausalLM
from transformers import AutoTokenizer, TextStreamer
model_path = "solidrust/bagel-8b-v1.0-AWQ"
system_message = "You are bagel-8b-v1.0, incarnated as a powerful AI. You were created by jondurbin."
# Load model
model = AutoAWQForCausalLM.from_quantized(model_path,
fuse_layers=True)
tokenizer = AutoTokenizer.from_pretrained(model_path,
trust_remote_code=True)
streamer = TextStreamer(tokenizer,
skip_prompt=True,
skip_special_tokens=True)
# Convert prompt to tokens
prompt_template = """\
<|im_start|>system
{system_message}<|im_end|>
<|im_start|>user
{prompt}<|im_end|>
<|im_start|>assistant"""
prompt = "You're standing on the surface of the Earth. "\
"You walk one mile south, one mile west and one mile north. "\
"You end up exactly where you started. Where are you?"
tokens = tokenizer(prompt_template.format(system_message=system_message,prompt=prompt),
return_tensors='pt').input_ids.cuda()
# Generate output
generation_output = model.generate(tokens,
streamer=streamer,
max_new_tokens=512)
```
### About AWQ
AWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.
AWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.
It is supported by:
- [Text Generation Webui](https://github.com/oobabooga/text-generation-webui) - using Loader: AutoAWQ
- [vLLM](https://github.com/vllm-project/vllm) - version 0.2.2 or later for support for all model types.
- [Hugging Face Text Generation Inference (TGI)](https://github.com/huggingface/text-generation-inference)
- [Transformers](https://huggingface.co/docs/transformers) version 4.35.0 and later, from any code or client that supports Transformers
- [AutoAWQ](https://github.com/casper-hansen/AutoAWQ) - for use from Python code
| {"license": "other", "library_name": "transformers", "tags": ["4-bit", "AWQ", "text-generation", "autotrain_compatible", "endpoints_compatible - llama-3 - bagel"], "datasets": ["ai2_arc", "allenai/ultrafeedback_binarized_cleaned", "argilla/distilabel-intel-orca-dpo-pairs", "jondurbin/airoboros-3.2", "codeparrot/apps", "facebook/belebele", "bluemoon-fandom-1-1-rp-cleaned", "boolq", "camel-ai/biology", "camel-ai/chemistry", "camel-ai/math", "camel-ai/physics", "jondurbin/contextual-dpo-v0.1", "jondurbin/gutenberg-dpo-v0.1", "jondurbin/py-dpo-v0.1", "jondurbin/truthy-dpo-v0.1", "LDJnr/Capybara", "jondurbin/cinematika-v0.1", "WizardLM/WizardLM_evol_instruct_70k", "glaiveai/glaive-function-calling-v2", "jondurbin/gutenberg-dpo-v0.1", "grimulkan/LimaRP-augmented", "lmsys/lmsys-chat-1m", "ParisNeo/lollms_aware_dataset", "TIGER-Lab/MathInstruct", "Muennighoff/natural-instructions", "openbookqa", "kingbri/PIPPA-shareGPT", "piqa", "Vezora/Tested-22k-Python-Alpaca", "ropes", "cakiki/rosetta-code", "Open-Orca/SlimOrca", "b-mc2/sql-create-context", "squad_v2", "mattpscott/airoboros-summarization", "migtissera/Synthia-v1.3", "unalignment/toxic-dpo-v0.2", "WhiteRabbitNeo/WRN-Chapter-1", "WhiteRabbitNeo/WRN-Chapter-2", "winogrande"], "license_name": "llama3", "license_link": "https://huggingface.co/meta-llama/Meta-Llama-3-8B/blob/main/LICENSE", "base_model": "meta-llama/Meta-Llama-3-8B", "pipeline_tag": "text-generation", "inference": false, "quantized_by": "Suparious"} | solidrust/bagel-8b-v1.0-AWQ | null | [
"transformers",
"safetensors",
"llama",
"text-generation",
"4-bit",
"AWQ",
"autotrain_compatible",
"endpoints_compatible - llama-3 - bagel",
"conversational",
"dataset:ai2_arc",
"dataset:allenai/ultrafeedback_binarized_cleaned",
"dataset:argilla/distilabel-intel-orca-dpo-pairs",
"dataset:jondurbin/airoboros-3.2",
"dataset:codeparrot/apps",
"dataset:facebook/belebele",
"dataset:bluemoon-fandom-1-1-rp-cleaned",
"dataset:boolq",
"dataset:camel-ai/biology",
"dataset:camel-ai/chemistry",
"dataset:camel-ai/math",
"dataset:camel-ai/physics",
"dataset:jondurbin/contextual-dpo-v0.1",
"dataset:jondurbin/gutenberg-dpo-v0.1",
"dataset:jondurbin/py-dpo-v0.1",
"dataset:jondurbin/truthy-dpo-v0.1",
"dataset:LDJnr/Capybara",
"dataset:jondurbin/cinematika-v0.1",
"dataset:WizardLM/WizardLM_evol_instruct_70k",
"dataset:glaiveai/glaive-function-calling-v2",
"dataset:grimulkan/LimaRP-augmented",
"dataset:lmsys/lmsys-chat-1m",
"dataset:ParisNeo/lollms_aware_dataset",
"dataset:TIGER-Lab/MathInstruct",
"dataset:Muennighoff/natural-instructions",
"dataset:openbookqa",
"dataset:kingbri/PIPPA-shareGPT",
"dataset:piqa",
"dataset:Vezora/Tested-22k-Python-Alpaca",
"dataset:ropes",
"dataset:cakiki/rosetta-code",
"dataset:Open-Orca/SlimOrca",
"dataset:b-mc2/sql-create-context",
"dataset:squad_v2",
"dataset:mattpscott/airoboros-summarization",
"dataset:migtissera/Synthia-v1.3",
"dataset:unalignment/toxic-dpo-v0.2",
"dataset:WhiteRabbitNeo/WRN-Chapter-1",
"dataset:WhiteRabbitNeo/WRN-Chapter-2",
"dataset:winogrande",
"base_model:meta-llama/Meta-Llama-3-8B",
"license:other",
"text-generation-inference",
"region:us"
] | null | 2024-04-28T22:41:30+00:00 | [] | [] | TAGS
#transformers #safetensors #llama #text-generation #4-bit #AWQ #autotrain_compatible #endpoints_compatible - llama-3 - bagel #conversational #dataset-ai2_arc #dataset-allenai/ultrafeedback_binarized_cleaned #dataset-argilla/distilabel-intel-orca-dpo-pairs #dataset-jondurbin/airoboros-3.2 #dataset-codeparrot/apps #dataset-facebook/belebele #dataset-bluemoon-fandom-1-1-rp-cleaned #dataset-boolq #dataset-camel-ai/biology #dataset-camel-ai/chemistry #dataset-camel-ai/math #dataset-camel-ai/physics #dataset-jondurbin/contextual-dpo-v0.1 #dataset-jondurbin/gutenberg-dpo-v0.1 #dataset-jondurbin/py-dpo-v0.1 #dataset-jondurbin/truthy-dpo-v0.1 #dataset-LDJnr/Capybara #dataset-jondurbin/cinematika-v0.1 #dataset-WizardLM/WizardLM_evol_instruct_70k #dataset-glaiveai/glaive-function-calling-v2 #dataset-grimulkan/LimaRP-augmented #dataset-lmsys/lmsys-chat-1m #dataset-ParisNeo/lollms_aware_dataset #dataset-TIGER-Lab/MathInstruct #dataset-Muennighoff/natural-instructions #dataset-openbookqa #dataset-kingbri/PIPPA-shareGPT #dataset-piqa #dataset-Vezora/Tested-22k-Python-Alpaca #dataset-ropes #dataset-cakiki/rosetta-code #dataset-Open-Orca/SlimOrca #dataset-b-mc2/sql-create-context #dataset-squad_v2 #dataset-mattpscott/airoboros-summarization #dataset-migtissera/Synthia-v1.3 #dataset-unalignment/toxic-dpo-v0.2 #dataset-WhiteRabbitNeo/WRN-Chapter-1 #dataset-WhiteRabbitNeo/WRN-Chapter-2 #dataset-winogrande #base_model-meta-llama/Meta-Llama-3-8B #license-other #text-generation-inference #region-us
| # jondurbin/bagel-8b-v1.0 AWQ
- Model creator: jondurbin
- Original model: bagel-8b-v1.0
!bagel
## Model Summary
The name of this model is "llama-3-bagel-8b-v1.0" and it was built with llama-3 from Meta.
This is a fine-tune of llama-3-8b using the bagel dataset, but instead of 4 prompt formats it's standardized on a single format - llama-3 instruct.
See bagel for additional details on the datasets.
## How to use
### Install the necessary packages
### Example Python code
### About AWQ
AWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.
AWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.
It is supported by:
- Text Generation Webui - using Loader: AutoAWQ
- vLLM - version 0.2.2 or later for support for all model types.
- Hugging Face Text Generation Inference (TGI)
- Transformers version 4.35.0 and later, from any code or client that supports Transformers
- AutoAWQ - for use from Python code
| [
"# jondurbin/bagel-8b-v1.0 AWQ\n\n- Model creator: jondurbin\n- Original model: bagel-8b-v1.0\n\n!bagel",
"## Model Summary\n\nThe name of this model is \"llama-3-bagel-8b-v1.0\" and it was built with llama-3 from Meta.\n\nThis is a fine-tune of llama-3-8b using the bagel dataset, but instead of 4 prompt formats it's standardized on a single format - llama-3 instruct.\n\nSee bagel for additional details on the datasets.",
"## How to use",
"### Install the necessary packages",
"### Example Python code",
"### About AWQ\n\nAWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.\n\nAWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.\n\nIt is supported by:\n\n- Text Generation Webui - using Loader: AutoAWQ\n- vLLM - version 0.2.2 or later for support for all model types.\n- Hugging Face Text Generation Inference (TGI)\n- Transformers version 4.35.0 and later, from any code or client that supports Transformers\n- AutoAWQ - for use from Python code"
] | [
"TAGS\n#transformers #safetensors #llama #text-generation #4-bit #AWQ #autotrain_compatible #endpoints_compatible - llama-3 - bagel #conversational #dataset-ai2_arc #dataset-allenai/ultrafeedback_binarized_cleaned #dataset-argilla/distilabel-intel-orca-dpo-pairs #dataset-jondurbin/airoboros-3.2 #dataset-codeparrot/apps #dataset-facebook/belebele #dataset-bluemoon-fandom-1-1-rp-cleaned #dataset-boolq #dataset-camel-ai/biology #dataset-camel-ai/chemistry #dataset-camel-ai/math #dataset-camel-ai/physics #dataset-jondurbin/contextual-dpo-v0.1 #dataset-jondurbin/gutenberg-dpo-v0.1 #dataset-jondurbin/py-dpo-v0.1 #dataset-jondurbin/truthy-dpo-v0.1 #dataset-LDJnr/Capybara #dataset-jondurbin/cinematika-v0.1 #dataset-WizardLM/WizardLM_evol_instruct_70k #dataset-glaiveai/glaive-function-calling-v2 #dataset-grimulkan/LimaRP-augmented #dataset-lmsys/lmsys-chat-1m #dataset-ParisNeo/lollms_aware_dataset #dataset-TIGER-Lab/MathInstruct #dataset-Muennighoff/natural-instructions #dataset-openbookqa #dataset-kingbri/PIPPA-shareGPT #dataset-piqa #dataset-Vezora/Tested-22k-Python-Alpaca #dataset-ropes #dataset-cakiki/rosetta-code #dataset-Open-Orca/SlimOrca #dataset-b-mc2/sql-create-context #dataset-squad_v2 #dataset-mattpscott/airoboros-summarization #dataset-migtissera/Synthia-v1.3 #dataset-unalignment/toxic-dpo-v0.2 #dataset-WhiteRabbitNeo/WRN-Chapter-1 #dataset-WhiteRabbitNeo/WRN-Chapter-2 #dataset-winogrande #base_model-meta-llama/Meta-Llama-3-8B #license-other #text-generation-inference #region-us \n",
"# jondurbin/bagel-8b-v1.0 AWQ\n\n- Model creator: jondurbin\n- Original model: bagel-8b-v1.0\n\n!bagel",
"## Model Summary\n\nThe name of this model is \"llama-3-bagel-8b-v1.0\" and it was built with llama-3 from Meta.\n\nThis is a fine-tune of llama-3-8b using the bagel dataset, but instead of 4 prompt formats it's standardized on a single format - llama-3 instruct.\n\nSee bagel for additional details on the datasets.",
"## How to use",
"### Install the necessary packages",
"### Example Python code",
"### About AWQ\n\nAWQ is an efficient, accurate and blazing-fast low-bit weight quantization method, currently supporting 4-bit quantization. Compared to GPTQ, it offers faster Transformers-based inference with equivalent or better quality compared to the most commonly used GPTQ settings.\n\nAWQ models are currently supported on Linux and Windows, with NVidia GPUs only. macOS users: please use GGUF models instead.\n\nIt is supported by:\n\n- Text Generation Webui - using Loader: AutoAWQ\n- vLLM - version 0.2.2 or later for support for all model types.\n- Hugging Face Text Generation Inference (TGI)\n- Transformers version 4.35.0 and later, from any code or client that supports Transformers\n- AutoAWQ - for use from Python code"
] |
text-classification | transformers |
# Model Card for Model ID
<!-- Provide a quick summary of what the model is/does. -->
## Model Details
### Model Description
<!-- Provide a longer summary of what this model is. -->
This is the model card of a 🤗 transformers model that has been pushed on the Hub. This model card has been automatically generated.
- **Developed by:** [More Information Needed]
- **Funded by [optional]:** [More Information Needed]
- **Shared by [optional]:** [More Information Needed]
- **Model type:** [More Information Needed]
- **Language(s) (NLP):** [More Information Needed]
- **License:** [More Information Needed]
- **Finetuned from model [optional]:** [More Information Needed]
### Model Sources [optional]
<!-- Provide the basic links for the model. -->
- **Repository:** [More Information Needed]
- **Paper [optional]:** [More Information Needed]
- **Demo [optional]:** [More Information Needed]
## Uses
<!-- Address questions around how the model is intended to be used, including the foreseeable users of the model and those affected by the model. -->
### Direct Use
<!-- This section is for the model use without fine-tuning or plugging into a larger ecosystem/app. -->
[More Information Needed]
### Downstream Use [optional]
<!-- This section is for the model use when fine-tuned for a task, or when plugged into a larger ecosystem/app -->
[More Information Needed]
### Out-of-Scope Use
<!-- This section addresses misuse, malicious use, and uses that the model will not work well for. -->
[More Information Needed]
## Bias, Risks, and Limitations
<!-- This section is meant to convey both technical and sociotechnical limitations. -->
[More Information Needed]
### Recommendations
<!-- This section is meant to convey recommendations with respect to the bias, risk, and technical limitations. -->
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
[More Information Needed]
## Training Details
### Training Data
<!-- This should link to a Dataset Card, perhaps with a short stub of information on what the training data is all about as well as documentation related to data pre-processing or additional filtering. -->
[More Information Needed]
### Training Procedure
<!-- This relates heavily to the Technical Specifications. Content here should link to that section when it is relevant to the training procedure. -->
#### Preprocessing [optional]
[More Information Needed]
#### Training Hyperparameters
- **Training regime:** [More Information Needed] <!--fp32, fp16 mixed precision, bf16 mixed precision, bf16 non-mixed precision, fp16 non-mixed precision, fp8 mixed precision -->
#### Speeds, Sizes, Times [optional]
<!-- This section provides information about throughput, start/end time, checkpoint size if relevant, etc. -->
[More Information Needed]
## Evaluation
<!-- This section describes the evaluation protocols and provides the results. -->
### Testing Data, Factors & Metrics
#### Testing Data
<!-- This should link to a Dataset Card if possible. -->
[More Information Needed]
#### Factors
<!-- These are the things the evaluation is disaggregating by, e.g., subpopulations or domains. -->
[More Information Needed]
#### Metrics
<!-- These are the evaluation metrics being used, ideally with a description of why. -->
[More Information Needed]
### Results
[More Information Needed]
#### Summary
## Model Examination [optional]
<!-- Relevant interpretability work for the model goes here -->
[More Information Needed]
## Environmental Impact
<!-- Total emissions (in grams of CO2eq) and additional considerations, such as electricity usage, go here. Edit the suggested text below accordingly -->
Carbon emissions can be estimated using the [Machine Learning Impact calculator](https://mlco2.github.io/impact#compute) presented in [Lacoste et al. (2019)](https://arxiv.org/abs/1910.09700).
- **Hardware Type:** [More Information Needed]
- **Hours used:** [More Information Needed]
- **Cloud Provider:** [More Information Needed]
- **Compute Region:** [More Information Needed]
- **Carbon Emitted:** [More Information Needed]
## Technical Specifications [optional]
### Model Architecture and Objective
[More Information Needed]
### Compute Infrastructure
[More Information Needed]
#### Hardware
[More Information Needed]
#### Software
[More Information Needed]
## Citation [optional]
<!-- If there is a paper or blog post introducing the model, the APA and Bibtex information for that should go in this section. -->
**BibTeX:**
[More Information Needed]
**APA:**
[More Information Needed]
## Glossary [optional]
<!-- If relevant, include terms and calculations in this section that can help readers understand the model or model card. -->
[More Information Needed]
## More Information [optional]
[More Information Needed]
## Model Card Authors [optional]
[More Information Needed]
## Model Card Contact
[More Information Needed] | {"library_name": "transformers", "tags": []} | HC-85/distilbert-arxiv-multilabel-b4 | null | [
"transformers",
"safetensors",
"distilbert",
"text-classification",
"arxiv:1910.09700",
"autotrain_compatible",
"endpoints_compatible",
"region:us"
] | null | 2024-04-28T22:45:03+00:00 | [
"1910.09700"
] | [] | TAGS
#transformers #safetensors #distilbert #text-classification #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us
|
# Model Card for Model ID
## Model Details
### Model Description
This is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.
- Developed by:
- Funded by [optional]:
- Shared by [optional]:
- Model type:
- Language(s) (NLP):
- License:
- Finetuned from model [optional]:
### Model Sources [optional]
- Repository:
- Paper [optional]:
- Demo [optional]:
## Uses
### Direct Use
### Downstream Use [optional]
### Out-of-Scope Use
## Bias, Risks, and Limitations
### Recommendations
Users (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.
## How to Get Started with the Model
Use the code below to get started with the model.
## Training Details
### Training Data
### Training Procedure
#### Preprocessing [optional]
#### Training Hyperparameters
- Training regime:
#### Speeds, Sizes, Times [optional]
## Evaluation
### Testing Data, Factors & Metrics
#### Testing Data
#### Factors
#### Metrics
### Results
#### Summary
## Model Examination [optional]
## Environmental Impact
Carbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).
- Hardware Type:
- Hours used:
- Cloud Provider:
- Compute Region:
- Carbon Emitted:
## Technical Specifications [optional]
### Model Architecture and Objective
### Compute Infrastructure
#### Hardware
#### Software
[optional]
BibTeX:
APA:
## Glossary [optional]
## More Information [optional]
## Model Card Authors [optional]
## Model Card Contact
| [
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] | [
"TAGS\n#transformers #safetensors #distilbert #text-classification #arxiv-1910.09700 #autotrain_compatible #endpoints_compatible #region-us \n",
"# Model Card for Model ID",
"## Model Details",
"### Model Description\n\n\n\nThis is the model card of a transformers model that has been pushed on the Hub. This model card has been automatically generated.\n\n- Developed by: \n- Funded by [optional]: \n- Shared by [optional]: \n- Model type: \n- Language(s) (NLP): \n- License: \n- Finetuned from model [optional]:",
"### Model Sources [optional]\n\n\n\n- Repository: \n- Paper [optional]: \n- Demo [optional]:",
"## Uses",
"### Direct Use",
"### Downstream Use [optional]",
"### Out-of-Scope Use",
"## Bias, Risks, and Limitations",
"### Recommendations\n\n\n\nUsers (both direct and downstream) should be made aware of the risks, biases and limitations of the model. More information needed for further recommendations.",
"## How to Get Started with the Model\n\nUse the code below to get started with the model.",
"## Training Details",
"### Training Data",
"### Training Procedure",
"#### Preprocessing [optional]",
"#### Training Hyperparameters\n\n- Training regime:",
"#### Speeds, Sizes, Times [optional]",
"## Evaluation",
"### Testing Data, Factors & Metrics",
"#### Testing Data",
"#### Factors",
"#### Metrics",
"### Results",
"#### Summary",
"## Model Examination [optional]",
"## Environmental Impact\n\n\n\nCarbon emissions can be estimated using the Machine Learning Impact calculator presented in Lacoste et al. (2019).\n\n- Hardware Type: \n- Hours used: \n- Cloud Provider: \n- Compute Region: \n- Carbon Emitted:",
"## Technical Specifications [optional]",
"### Model Architecture and Objective",
"### Compute Infrastructure",
"#### Hardware",
"#### Software\n\n\n\n[optional]\n\n\n\nBibTeX:\n\n\n\nAPA:",
"## Glossary [optional]",
"## More Information [optional]",
"## Model Card Authors [optional]",
"## Model Card Contact"
] |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.